Lus10028018 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G48540 39 / 0.0004 receptor-like protein kinase-related family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012369 121 / 5e-36 AT4G11470 42 / 6e-05 cysteine-rich RLK (RECEPTOR-like protein kinase) 31 (.1)
Lus10028019 117 / 2e-34 AT1G70530 44 / 8e-06 cysteine-rich RLK (RECEPTOR-like protein kinase) 3 (.1)
Lus10015472 115 / 9e-34 AT5G48540 42 / 4e-05 receptor-like protein kinase-related family protein (.1)
Lus10003724 112 / 3e-32 AT1G70530 45 / 7e-06 cysteine-rich RLK (RECEPTOR-like protein kinase) 3 (.1)
Lus10028020 99 / 5e-26 ND /
Lus10028017 90 / 1e-21 AT1G03250 316 / 1e-106 unknown protein
Lus10020927 63 / 4e-13 AT1G19090 45 / 7e-06 CYSTEINE-RICH RLK \(RECEPTOR-LIKE PROTEIN KINASE\) 1, receptor-like serine/threonine kinase 2 (.1)
Lus10033450 60 / 5e-12 AT1G19090 45 / 7e-06 CYSTEINE-RICH RLK \(RECEPTOR-LIKE PROTEIN KINASE\) 1, receptor-like serine/threonine kinase 2 (.1)
Lus10011894 56 / 3e-10 AT3G60720 38 / 9e-04 plasmodesmata-located protein 8 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G208400 45 / 1e-06 AT5G48540 52 / 1e-08 receptor-like protein kinase-related family protein (.1)
Potri.004G023788 45 / 4e-06 AT4G23180 559 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G024052 45 / 4e-06 AT4G23180 545 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G024101 45 / 8e-06 AT4G23180 531 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G024900 44 / 2e-05 AT4G23180 506 / 1e-171 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G025900 44 / 2e-05 AT4G23130 573 / 0.0 RECEPTOR-LIKE PROTEIN KINASE 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.2)
Potri.004G024228 44 / 2e-05 AT4G23180 551 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G024404 43 / 3e-05 AT4G23180 671 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.011G028100 42 / 7e-05 AT4G05200 519 / 8e-177 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.002G145400 40 / 0.0002 AT3G60720 243 / 8e-80 plasmodesmata-located protein 8 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10028018 pacid=23181148 polypeptide=Lus10028018 locus=Lus10028018.g ID=Lus10028018.BGIv1.0 annot-version=v1.0
ATGGTGGGTTCTGGTTGTCGTGATCAAAAGCCATCAAAAGTACTAGCACGAATCCTACTCGCAACATCGTATGGAGTGATCATCATCATCGGGCTCGAGC
ATCGGCAGAGCACACCATTGTTCGTGTCGAGCTTGGATGTGAACGAGTGGGGATGCAACCCCTATGAGTTTCCAGCGCACGATGTAAGAAGAGCTCTCAC
AGGACCACTTCTACAAAAACTTGTAGATAGTGGATTGTTTGATTTGGATGTTCGGGCTACCAACGCATTGTCCCCTCCGGAGGATCACCCTTTGCTATAT
GCCTACGCCAATTGCACCACCGGTCCGATCTCTTACAATGACTGCCATGGATGTTTGAAGTCGGCCAAACAAACTCTGCTTGGAGAGTGCCCCCATCGAC
TCGGGGCTCAAGTGCTTTTAGACGTGTGTTATATGAGGTACGAGGAATATGCCTTGTAG
AA sequence
>Lus10028018 pacid=23181148 polypeptide=Lus10028018 locus=Lus10028018.g ID=Lus10028018.BGIv1.0 annot-version=v1.0
MVGSGCRDQKPSKVLARILLATSYGVIIIIGLEHRQSTPLFVSSLDVNEWGCNPYEFPAHDVRRALTGPLLQKLVDSGLFDLDVRATNALSPPEDHPLLY
AYANCTTGPISYNDCHGCLKSAKQTLLGECPHRLGAQVLLDVCYMRYEEYAL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10028018 0 1
Lus10035794 5.8 0.6099
AT1G29195 unknown protein Lus10002327 9.9 0.7024
Lus10034545 11.2 0.6949
AT5G38435 SPH8 S-protein homologue 8 (.1) Lus10016168 12.1 0.6949
Lus10001089 12.5 0.7011
AT4G16195 Plant self-incompatibility pro... Lus10017929 13.0 0.6949
AT1G29430 SAUR-like auxin-responsive pro... Lus10007059 13.7 0.6949
AT1G01110 IQD18 IQ-domain 18 (.1.2) Lus10008876 13.8 0.7157
AT5G67090 Subtilisin-like serine endopep... Lus10002044 14.5 0.6949
AT1G65890 AAE12 acyl activating enzyme 12 (.1) Lus10020787 14.8 0.7262

Lus10028018 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.