Lus10028019 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G70530 44 / 1e-05 CRK3 cysteine-rich RLK (RECEPTOR-like protein kinase) 3 (.1)
AT5G48540 42 / 5e-05 receptor-like protein kinase-related family protein (.1)
AT4G05200 41 / 7e-05 CRK25 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
AT3G60720 40 / 0.0002 PDLP8 plasmodesmata-located protein 8 (.1)
AT4G21400 39 / 0.0005 CRK28 cysteine-rich RLK (RECEPTOR-like protein kinase) 28 (.1)
AT4G21230 39 / 0.0006 CRK27 cysteine-rich RLK (RECEPTOR-like protein kinase) 27 (.1)
AT1G19090 39 / 0.0008 CRK1, RKF2 CYSTEINE-RICH RLK \(RECEPTOR-LIKE PROTEIN KINASE\) 1, receptor-like serine/threonine kinase 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012369 189 / 4e-63 AT4G11470 42 / 6e-05 cysteine-rich RLK (RECEPTOR-like protein kinase) 31 (.1)
Lus10015472 140 / 2e-43 AT5G48540 42 / 4e-05 receptor-like protein kinase-related family protein (.1)
Lus10028018 113 / 6e-33 ND 39 / 5e-04
Lus10003724 101 / 3e-28 AT1G70530 45 / 7e-06 cysteine-rich RLK (RECEPTOR-like protein kinase) 3 (.1)
Lus10028017 76 / 7e-17 AT1G03250 316 / 1e-106 unknown protein
Lus10011894 62 / 6e-13 AT3G60720 38 / 9e-04 plasmodesmata-located protein 8 (.1)
Lus10022828 59 / 7e-12 AT2G01660 43 / 2e-05 plasmodesmata-located protein 6 (.1.2)
Lus10033450 56 / 2e-10 AT1G19090 45 / 7e-06 CYSTEINE-RICH RLK \(RECEPTOR-LIKE PROTEIN KINASE\) 1, receptor-like serine/threonine kinase 2 (.1)
Lus10033389 53 / 2e-09 AT1G19090 44 / 2e-05 CYSTEINE-RICH RLK \(RECEPTOR-LIKE PROTEIN KINASE\) 1, receptor-like serine/threonine kinase 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G024900 50 / 7e-08 AT4G23180 506 / 1e-171 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.005G208400 49 / 7e-08 AT5G48540 52 / 1e-08 receptor-like protein kinase-related family protein (.1)
Potri.004G025900 50 / 8e-08 AT4G23130 573 / 0.0 RECEPTOR-LIKE PROTEIN KINASE 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.2)
Potri.004G024404 47 / 8e-07 AT4G23180 671 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.011G028100 47 / 1e-06 AT4G05200 519 / 8e-177 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.004G025001 44 / 8e-06 AT4G05200 465 / 4e-158 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.004G025650 44 / 1e-05 AT4G23180 646 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G024500 42 / 3e-05 AT4G23180 675 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G024800 42 / 3e-05 AT4G23180 663 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G026200 42 / 6e-05 AT4G05200 573 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10028019 pacid=23181251 polypeptide=Lus10028019 locus=Lus10028019.g ID=Lus10028019.BGIv1.0 annot-version=v1.0
ATGGGAGCAGTACTTGCACTGCTAGTGGTGGCAATCGCTGGAGTACTGATCATCGGACCTCATCATGTCGCGAGCCTCGAAGTGAAAAATTGGGAATGCA
ACACCTCCGAGTACCCACCACACGACGTAAAGAGAACCCTCGTCCAAATCCTTCTACAAGAACTGGTGGACAGCAGATTACCATATTGGAAAGTCCGTGG
CCTGGGGACATCGATTCCTAGCAAGAACCCTTTGATTTACGCCTACGCCAACTGCACTGGTGCTGCTGATCCTTGGTACCATGACGATGATTGTAGCCCA
TGTCTGAGGCTGGCGAAACAAAGCCTACTTCGTAATTGTCCCCATCGAGTCGGGGCAAAAGTGTACTTCGACTCTTGTTATATGAGGTATGAAAATTACT
TCTTCTAA
AA sequence
>Lus10028019 pacid=23181251 polypeptide=Lus10028019 locus=Lus10028019.g ID=Lus10028019.BGIv1.0 annot-version=v1.0
MGAVLALLVVAIAGVLIIGPHHVASLEVKNWECNTSEYPPHDVKRTLVQILLQELVDSRLPYWKVRGLGTSIPSKNPLIYAYANCTGAADPWYHDDDCSP
CLRLAKQSLLRNCPHRVGAKVYFDSCYMRYENYFF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G70530 CRK3 cysteine-rich RLK (RECEPTOR-li... Lus10028019 0 1

Lus10028019 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.