Lus10028021 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G26594 99 / 2e-27 ARR24 response regulator 24 (.1)
AT3G04280 80 / 5e-20 ARR22 response regulator 22 (.1.2.3)
AT2G47430 58 / 1e-10 CKI1 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1)
AT1G27320 44 / 1e-05 AHK3 histidine kinase 3 (.1)
AT5G10720 39 / 0.0007 CKI2, AHK5 CYTOKININ INDEPENDENT 2, histidine kinase 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005407 116 / 3e-34 AT5G26594 135 / 2e-41 response regulator 24 (.1)
Lus10004775 81 / 1e-20 AT5G26594 98 / 2e-27 response regulator 24 (.1)
Lus10029849 61 / 1e-11 AT2G47430 489 / 2e-153 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1)
Lus10033746 55 / 2e-09 AT2G47430 615 / 0.0 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1)
Lus10031600 54 / 4e-09 AT2G47430 624 / 0.0 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1)
Lus10000105 43 / 4e-06 AT5G10720 114 / 7e-31 CYTOKININ INDEPENDENT 2, histidine kinase 5 (.1)
Lus10000137 43 / 6e-06 AT5G10720 113 / 1e-30 CYTOKININ INDEPENDENT 2, histidine kinase 5 (.1)
Lus10020114 42 / 1e-05 AT5G10720 177 / 2e-52 CYTOKININ INDEPENDENT 2, histidine kinase 5 (.1)
Lus10026917 43 / 3e-05 AT5G10720 1063 / 0.0 CYTOKININ INDEPENDENT 2, histidine kinase 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G108000 112 / 9e-33 AT5G26594 163 / 5e-53 response regulator 24 (.1)
Potri.002G253000 112 / 1e-32 AT5G26594 171 / 5e-56 response regulator 24 (.1)
Potri.019G024900 77 / 5e-19 AT5G26594 121 / 2e-36 response regulator 24 (.1)
Potri.019G025000 69 / 7e-16 AT5G26594 117 / 2e-34 response regulator 24 (.1)
Potri.003G177400 70 / 4e-15 AT3G04280 99 / 9e-26 response regulator 22 (.1.2.3)
Potri.001G050900 70 / 5e-15 AT3G04280 83 / 4e-19 response regulator 22 (.1.2.3)
Potri.003G177300 69 / 7e-15 AT3G04280 96 / 8e-25 response regulator 22 (.1.2.3)
Potri.003G172750 59 / 3e-12 AT3G04280 80 / 1e-20 response regulator 22 (.1.2.3)
Potri.001G050800 61 / 4e-12 AT5G26594 77 / 4e-18 response regulator 24 (.1)
Potri.003G172866 62 / 6e-12 AT3G04280 85 / 2e-19 response regulator 22 (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0304 CheY PF00072 Response_reg Response regulator receiver domain
Representative CDS sequence
>Lus10028021 pacid=23181139 polypeptide=Lus10028021 locus=Lus10028021.g ID=Lus10028021.BGIv1.0 annot-version=v1.0
ATGGGATCTGAAGATAGCAATAAGTACAGTATGATCAAAGCTCTAGTTGTGGACGACGAACCGGTCGCGAAGCTTCTCCACGCCAAATATCTGGAGAAAA
TCGGCATTATGAACCACAAGGTTGTCAGCAATGGCAAGGAAGCTGTCGAATTGGTTACTTCGTTGGGTGTCGAATATTTCGATGTCATTCTCATGGATAT
CGATATGCCTCTTATGAACGGAATCACGGCAACAAAGAAGCTGCGTGACATGGGAGTACGGAACATGATCGTGGGGGTATCGTCGCGTTCACGAACTGAT
GAACTGATCATAGCAACTATGGAGAGTGGAATTATGGATGATTACGTACTGAAACCTTTAATCCCTGCCAATGTCATCTCTTTTGCAGAGAAGATTATTC
AAAGCTCTGCTTAA
AA sequence
>Lus10028021 pacid=23181139 polypeptide=Lus10028021 locus=Lus10028021.g ID=Lus10028021.BGIv1.0 annot-version=v1.0
MGSEDSNKYSMIKALVVDDEPVAKLLHAKYLEKIGIMNHKVVSNGKEAVELVTSLGVEYFDVILMDIDMPLMNGITATKKLRDMGVRNMIVGVSSRSRTD
ELIIATMESGIMDDYVLKPLIPANVISFAEKIIQSSA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G26594 ARR24 response regulator 24 (.1) Lus10028021 0 1

Lus10028021 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.