Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G33970 177 / 9e-55 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) AT4G09940 179 / 3e-54 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G33930 164 / 3e-49 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G33950 158 / 4e-47 Avirulence induced gene (AIG1) family protein (.1), Avirulence induced gene (AIG1) family protein (.2) AT2G26820 157 / 4e-45 ATPP2-A3 phloem protein 2-A3 (.1) AT1G33960 152 / 3e-44 AIG1 AVRRPT2-INDUCED GENE 1, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G33900 149 / 2e-43 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT4G09950 142 / 1e-40 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G33890 141 / 4e-40 Avirulence induced gene (AIG1) family protein (.1) AT4G09930 140 / 1e-39 Avirulence induced gene (AIG1) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003732 [exp] 234 / 2e-76 AT1G33970 210 / 1e-65 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) Lus10005300 [exp] 230 / 1e-73 AT1G33970 321 / 7e-109 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) Lus10005299 [exp] 216 / 3e-68 AT1G33970 339 / 5e-115 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) Lus10009485 [exp] 202 / 4e-66 AT1G33970 142 / 2e-42 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) Lus10026891 [exp] 138 / 4e-40 AT2G26820 156 / 2e-45 phloem protein 2-A3 (.1) Lus10009483 [exp] 91 / 4e-23 AT1G33970 91 / 3e-23 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) Lus10003507 [exp] 80 / 2e-19 AT1G33930 82 / 3e-20 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10009482 [exp] 59 / 5e-10 AT1G33970 148 / 9e-43 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) Lus10009484 [exp] 57 / 2e-09 AT4G26220 255 / 1e-83 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G077300 [exp] 234 / 4e-76 AT1G33970 345 / 2e-118 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) Potri.013G104800 [exp] 232 / 1e-75 AT1G33970 314 / 3e-106 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) Potri.010G014300 [exp] 44 / 5e-05 AT4G02510 812 / 0.0 TRANSLOCON AT THE OUTER ENVELOPE MEMBRANE OF CHLOROPLASTS 86, TRANSLOCON AT THE OUTER ENVELOPE MEMBRANE OF CHLOROPLASTS 160, PLASTID PROTEIN IMPORT 2, translocon at the outer envelope membrane of chloroplasts 159 (.1) Potri.008G224900 [exp] 42 / 0.0004 AT4G02510 847 / 0.0 TRANSLOCON AT THE OUTER ENVELOPE MEMBRANE OF CHLOROPLASTS 86, TRANSLOCON AT THE OUTER ENVELOPE MEMBRANE OF CHLOROPLASTS 160, PLASTID PROTEIN IMPORT 2, translocon at the outer envelope membrane of chloroplasts 159 (.1) Potri.008G225000 [exp] 42 / 0.0004 AT4G02510 790 / 0.0 TRANSLOCON AT THE OUTER ENVELOPE MEMBRANE OF CHLOROPLASTS 86, TRANSLOCON AT THE OUTER ENVELOPE MEMBRANE OF CHLOROPLASTS 160, PLASTID PROTEIN IMPORT 2, translocon at the outer envelope membrane of chloroplasts 159 (.1) Potri.009G131200 [exp] 42 / 0.0005 AT3G16620 1129 / 0.0 ARABIDOPSIS THALIANA TRANSLOCON OUTER COMPLEX PROTEIN 120, translocon outer complex protein 120 (.1) Potri.004G171600 [exp] 42 / 0.0005 AT3G16620 1128 / 0.0 ARABIDOPSIS THALIANA TRANSLOCON OUTER COMPLEX PROTEIN 120, translocon outer complex protein 120 (.1) Potri.002G183400 [exp] 40 / 0.0006 AT1G02280 417 / 6e-148 PLASTID PROTEIN IMPORT 1, translocon at the outer envelope membrane of chloroplasts 33 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF04548 [flax] [poplar] AIG1 AIG1 family
Representative CDS sequence Show only first row Show all	>Lus10028023 pacid=23181133 polypeptide=Lus10028023 locus=Lus10028023.g ID=Lus10028023.BGIv1.0 annot-version=v1.0 ATGGGAGGATCTACCTTTGAAAACGACTGGGAGTTGACCGAGCCAACTAGTGGGATGGCTCGAACAATTGTACTAGTTGGTCGTACTGGTAATGGCAAGA GTGCCACCGGCAATACCATCCTGGGCAGAAAAGCTTTCAAGTCTAGGAGTAGCTCTCTTGGCGTTACGAGTAGCTGTGAATTGCAGTCAACTGTTTTGAA CGATGGTCAGATCCTAAATGTCATTGATACTCCAGGGCTGTTTGATCCTACAATGGATTCTGATTTCGTTTGCAAGGAAATTGCAAACTGCATCAAAATG ACACGGGATGGGATACATTCTGTCATCGTTGTTTCCTCCTTGAGGAATCGATTTACAGAAGAAGAGAAAACAGCAGTTCTTAGCCTGCAATCATTGTCCG GAACCAACATAACCGACTCCTTGATTGTTCTCTTCACCGGAGGAGAAGATCTTGAAGACAATGACGAAAGTTTCAACGATTATCTGTGTAATGATTCTGA AGGCAGCTCTCCTTTAAAGGTTAATGCACAGCATTTTAAAGGGAGAAGGAAGAAGGAAGCAAAAGAGGCTCAAGAGAAACTACTGAGAGCAAAGAAGGAT CTTAAAAAGAAGGCTATGAAGGTAAAGGAGCTTTGCGAGCAGCGTGCTAGGGAGGCTGAGGAGGTTCGTAAGCAGCATGCTAGGGAGGCCGAGGAGCGTC ACAGGCTGCTTGCTGAGAAAAATTCATGTTCAATTCTTAGTTAG
AA sequence Show only first row Show all	>Lus10028023 pacid=23181133 polypeptide=Lus10028023 locus=Lus10028023.g ID=Lus10028023.BGIv1.0 annot-version=v1.0 MGGSTFENDWELTEPTSGMARTIVLVGRTGNGKSATGNTILGRKAFKSRSSSLGVTSSCELQSTVLNDGQILNVIDTPGLFDPTMDSDFVCKEIANCIKM TRDGIHSVIVVSSLRNRFTEEEKTAVLSLQSLSGTNITDSLIVLFTGGEDLEDNDESFNDYLCNDSEGSSPLKVNAQHFKGRRKKEAKEAQEKLLRAKKD LKKKAMKVKELCEQRAREAEEVRKQHAREAEERHRLLAEKNSCSILS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G09940			P-loop containing nucleoside t...		Lus10028023 [exp]	0	1
AT5G04010			F-box family protein (.1)		Lus10031031 [exp]	8.5	0.7440
AT5G41650			Lactoylglutathione lyase / gly...		Lus10024719 [exp]	9.8	0.6981
					Lus10034718 [exp]	10.6	0.7777
					Lus10000293 [exp]	14.4	0.6678
AT1G01920			SET domain-containing protein ...		Lus10016435 [exp]	15.9	0.6793
AT2G19480		NFA2, NFA02, NA...	NUCLEOSOME/CHROMATIN ASSEMBLY ...		Lus10005551 [exp]	20.8	0.7592
					Lus10003693 [exp]	24.0	0.6881
AT2G41480			Peroxidase superfamily protein...		Lus10007052 [exp]	27.2	0.6991
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10010943 [exp]	28.7	0.7361
AT1G68390			Core-2/I-branching beta-1,6-N-...		Lus10036610 [exp]	32.5	0.7203

Compare expression of checked genes

Lus10028023 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.