Lus10028026 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G23290 42 / 3e-05 CRK21 cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.2)
AT4G21230 40 / 0.0002 CRK27 cysteine-rich RLK (RECEPTOR-like protein kinase) 27 (.1)
AT4G00970 39 / 0.0007 CRK41 cysteine-rich RLK (RECEPTOR-like protein kinase) 41 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003735 202 / 4e-68 AT4G23210 43 / 3e-05 cysteine-rich RLK (RECEPTOR-like protein kinase) 13 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 13 (.2), cysteine-rich RLK (RECEPTOR-like protein kinase) 13 (.3)
Lus10013257 52 / 3e-09 AT4G23300 51 / 3e-08 cysteine-rich RLK (RECEPTOR-like protein kinase) 22 (.1)
Lus10007504 50 / 5e-08 AT3G22040 42 / 3e-05 Domain of unknown function (DUF26) (.1)
Lus10022828 49 / 6e-08 AT2G01660 43 / 2e-05 plasmodesmata-located protein 6 (.1.2)
Lus10011894 49 / 9e-08 AT3G60720 38 / 9e-04 plasmodesmata-located protein 8 (.1)
Lus10028980 48 / 2e-07 AT3G21945 39 / 9e-04 Receptor-like protein kinase-related family protein (.1)
Lus10003724 47 / 3e-07 AT1G70530 45 / 7e-06 cysteine-rich RLK (RECEPTOR-like protein kinase) 3 (.1)
Lus10008656 46 / 7e-07 AT4G05200 44 / 8e-06 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10016710 47 / 1e-06 AT2G01660 318 / 1e-108 plasmodesmata-located protein 6 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G208400 145 / 6e-46 AT5G48540 52 / 1e-08 receptor-like protein kinase-related family protein (.1)
Potri.010G108100 50 / 7e-08 AT2G01660 265 / 2e-88 plasmodesmata-located protein 6 (.1.2)
Potri.008G133500 45 / 4e-06 AT2G01660 332 / 1e-114 plasmodesmata-located protein 6 (.1.2)
Potri.004G025425 44 / 9e-06 AT4G21410 556 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Potri.004G086000 44 / 1e-05 AT5G37660 301 / 1e-102 plasmodesmata-located protein 7 (.1.2)
Potri.004G032000 43 / 1e-05 AT3G22060 110 / 4e-29 Receptor-like protein kinase-related family protein (.1)
Potri.004G024566 43 / 2e-05 AT4G05200 177 / 7e-51 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.004G024404 43 / 2e-05 AT4G23180 671 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G026200 41 / 0.0001 AT4G05200 573 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.007G120300 40 / 0.0001 AT3G22060 194 / 1e-61 Receptor-like protein kinase-related family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10028026 pacid=23181225 polypeptide=Lus10028026 locus=Lus10028026.g ID=Lus10028026.BGIv1.0 annot-version=v1.0
ATGAATAATCTCATCCTCAAATCACCAACCTTACCCTTACTCCTCCTCATCCTCCTCCTCTCCACCTTCGCCGGCGGCGTCCCGAACACGAACGTCACGT
CACTCCTCTGCAACGCCAACACCTACACCTCCGGCGACCCCTTTGCCATCAGCCTGGACTACGTCGTCGGGGACATCGAGGCAAACGCTCCGGCTCACGA
CAAGTACGACTACTACAACATCTCCCCCTTCCCCAACGCCTTCGCCTACGGCCATGGCGTGTGTAATGTCAACATCACTCGCGCTGACTGTGCCGCCTGC
CTTGTAGCTGCGAAGACCGCGCTGGTTGCGGGCTGTCCTGACCGGATTGGGGGGCGGTCGGGTCTGGTTGATTGTTTGATTAGGTATGAACAGCGTCCTT
TTGTTGATGATCAGTAG
AA sequence
>Lus10028026 pacid=23181225 polypeptide=Lus10028026 locus=Lus10028026.g ID=Lus10028026.BGIv1.0 annot-version=v1.0
MNNLILKSPTLPLLLLILLLSTFAGGVPNTNVTSLLCNANTYTSGDPFAISLDYVVGDIEANAPAHDKYDYYNISPFPNAFAYGHGVCNVNITRADCAAC
LVAAKTALVAGCPDRIGGRSGLVDCLIRYEQRPFVDDQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G23290 CRK21 cysteine-rich RLK (RECEPTOR-li... Lus10028026 0 1
AT3G11340 UGT76B1 UDP-dependent glycosyltransfer... Lus10004673 7.7 0.8779
AT3G20640 bHLH bHLH123 basic helix-loop-helix (bHLH) ... Lus10029460 17.1 0.8049
AT5G05320 FAD/NAD(P)-binding oxidoreduct... Lus10025073 17.2 0.8153
AT3G55700 UDP-Glycosyltransferase superf... Lus10004674 17.6 0.8582
AT4G23100 ATECS1, CAD2, G... ROOT MERISTEMLESS 1, PHYTOALEX... Lus10002001 25.5 0.8337
AT1G54540 Late embryogenesis abundant (L... Lus10031317 29.2 0.8175
AT5G10530 Concanavalin A-like lectin pro... Lus10029555 33.9 0.8210
AT1G05260 RCI3A, RCI3 RARE COLD INDUCIBLE GENE 3, Pe... Lus10015580 36.7 0.7713
AT2G31081 CLE4 CLAVATA3/ESR-RELATED 4 (.1) Lus10015304 38.7 0.7780
AT1G25520 Uncharacterized protein family... Lus10021697 40.7 0.8148

Lus10028026 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.