Lus10028046 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G70690 40 / 0.0001 HWI1, PDLP5 PLASMODESMATA-LOCATED PROTEIN 5, HOPW1-1-INDUCED GENE1, Receptor-like protein kinase-related family protein (.1)
AT2G01660 39 / 0.0005 PDLP6 plasmodesmata-located protein 6 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003752 251 / 2e-87 AT1G70690 41 / 9e-05 PLASMODESMATA-LOCATED PROTEIN 5, HOPW1-1-INDUCED GENE1, Receptor-like protein kinase-related family protein (.1)
Lus10008314 114 / 2e-33 ND /
Lus10035753 112 / 8e-32 ND /
Lus10028050 105 / 9e-30 ND 36 / 0.004
Lus10028053 111 / 2e-29 AT3G11080 120 / 8e-29 receptor like protein 35 (.1)
Lus10008311 104 / 2e-29 ND 35 / 0.008
Lus10010116 104 / 3e-29 ND 36 / 0.007
Lus10012621 104 / 5e-29 ND 38 / 0.002
Lus10029618 98 / 9e-27 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G133500 45 / 5e-06 AT2G01660 332 / 1e-114 plasmodesmata-located protein 6 (.1.2)
Potri.010G108100 40 / 0.0002 AT2G01660 265 / 2e-88 plasmodesmata-located protein 6 (.1.2)
Potri.004G025425 40 / 0.0002 AT4G21410 556 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Potri.004G026200 40 / 0.0003 AT4G05200 573 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10028046 pacid=23181248 polypeptide=Lus10028046 locus=Lus10028046.g ID=Lus10028046.BGIv1.0 annot-version=v1.0
ATGGAGCACTGCAACTCAAAATCAACAACAGCAGCAATCCTTACCCTCCTCGGAGTACTACTAGTACTAGTCGACTGCAAAGTGGGTCCGGACATCAGCA
TCGTGAGAGGACCCACCTGCACCGGAATATCGAAGAACAATGGCTACACCAAGAGCGTGGGGAGTCTCCTCGACACCCTCGTCAAGGAGACTAAAAACGT
ACACAGGGACACGATCCACCAAATTTACAGGTACACCCGCCAGATCCCAGACTCCGAACCCGGGTCTGTGACCGGAACTGCAGTTTGTTCGGGTGAGTTG
GGTAAATCGGAATGCTGGGAGTGTTTGGCCCATGCCCAGGGGAAGCTGACTACGGGATGTGTTGATCCGGTTAAGGGCAGTATCAAGTTGCAGGATTGTT
CCATTTGGTTCGACAAAAAGTGTTGA
AA sequence
>Lus10028046 pacid=23181248 polypeptide=Lus10028046 locus=Lus10028046.g ID=Lus10028046.BGIv1.0 annot-version=v1.0
MEHCNSKSTTAAILTLLGVLLVLVDCKVGPDISIVRGPTCTGISKNNGYTKSVGSLLDTLVKETKNVHRDTIHQIYRYTRQIPDSEPGSVTGTAVCSGEL
GKSECWECLAHAQGKLTTGCVDPVKGSIKLQDCSIWFDKKC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G70690 HWI1, PDLP5 PLASMODESMATA-LOCATED PROTEIN ... Lus10028046 0 1
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Lus10001036 6.6 0.5477
Lus10015249 15.3 0.5267
AT5G53820 Late embryogenesis abundant pr... Lus10003056 16.5 0.5041
Lus10034849 19.7 0.4943
Lus10005203 31.6 0.4743
AT2G36870 XTH32 xyloglucan endotransglucosylas... Lus10026536 33.0 0.4744
AT3G10710 RHS12 root hair specific 12 (.1) Lus10034859 46.0 0.4867
Lus10010418 46.9 0.4695
Lus10008418 55.7 0.4575
AT4G12080 AT-hook ATAHL1, AHL1 AT-hook motif nuclear-localize... Lus10000177 61.5 0.4325

Lus10028046 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.