Lus10028048 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003757 263 / 6e-92 ND /
Lus10010117 231 / 2e-79 ND 39 / 4e-04
Lus10012621 188 / 5e-62 ND 38 / 0.002
Lus10010116 184 / 8e-61 ND 36 / 0.007
Lus10014738 164 / 4e-53 ND /
Lus10003758 166 / 1e-52 ND /
Lus10002731 156 / 2e-50 ND /
Lus10008311 110 / 7e-32 ND 35 / 0.008
Lus10035753 111 / 1e-31 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G208400 37 / 0.001 AT5G48540 52 / 1e-08 receptor-like protein kinase-related family protein (.1)
PFAM info
Representative CDS sequence
>Lus10028048 pacid=23181193 polypeptide=Lus10028048 locus=Lus10028048.g ID=Lus10028048.BGIv1.0 annot-version=v1.0
ATGTACTCCCCGTCAAAACTATACGCAACAGTGATTATGCTACTGTGTATAGTTGTTGACGGGAAACTCCCCGACAAGACCATCCTAAGCGGACCTGATT
GCATGGGGAAATCGACGACCAAAACGTACAATCACAATGTTAAGGGTCTCATGGCCAGCTTCGTAAAGGACACGCCGGAAAGTGAAAGGAATATATTGGG
GGACAGACAAATGAATCATAGCTACCCGAATCGAAACCCGGGGTCGCCTTTCGGAGTCTCCACATGCTACCAAGACCTTGGGAAGTTTGATTGTTGGAAC
TGTCTCTTCTCCGCTAAGGGTAAACTGGAAAAGGGTTGCTTGCATCCCATTGCTGCTACTGTAAGACTCCAGGACTGCTCCATCACTTTTAACATTACCG
TTGGAGTGCTTTGA
AA sequence
>Lus10028048 pacid=23181193 polypeptide=Lus10028048 locus=Lus10028048.g ID=Lus10028048.BGIv1.0 annot-version=v1.0
MYSPSKLYATVIMLLCIVVDGKLPDKTILSGPDCMGKSTTKTYNHNVKGLMASFVKDTPESERNILGDRQMNHSYPNRNPGSPFGVSTCYQDLGKFDCWN
CLFSAKGKLEKGCLHPIAATVRLQDCSITFNITVGVL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10028048 0 1
Lus10001123 2.4 1.0000
AT1G47550 SEC3A exocyst complex component sec3... Lus10001022 2.6 1.0000
Lus10023352 3.0 1.0000
AT5G67440 MEL2, NPY3 NAKED PINS IN YUC MUTANTS 3, M... Lus10025193 5.3 1.0000
AT4G14130 XTR7, XTH15 xyloglucan endotransglycosylas... Lus10008888 6.3 1.0000
Lus10009177 6.9 1.0000
AT1G54130 AT-RSH3, RSH3, ... RELA/SPOT homolog 3 (.1) Lus10011252 7.5 1.0000
Lus10035026 7.5 1.0000
AT5G04350 Plant self-incompatibility pro... Lus10029381 8.1 0.8034
AT5G49330 MYB PFG3, ATMYB111 PRODUCTION OF FLAVONOL GLYCOSI... Lus10000008 8.5 1.0000

Lus10028048 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.