Lus10028049 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G05200 38 / 0.001 CRK25 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010118 210 / 3e-71 AT1G04520 40 / 3e-04 plasmodesmata-located protein 2 (.1)
Lus10012623 208 / 2e-70 ND 38 / 0.001
Lus10003759 176 / 8e-58 ND 38 / 9e-04
Lus10010115 159 / 1e-51 AT5G48540 41 / 5e-05 receptor-like protein kinase-related family protein (.1)
Lus10003758 153 / 2e-47 ND /
Lus10035753 125 / 7e-37 ND /
Lus10008314 120 / 6e-36 ND /
Lus10028050 120 / 1e-35 ND 36 / 0.004
Lus10014738 112 / 1e-32 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G208400 48 / 8e-08 AT5G48540 52 / 1e-08 receptor-like protein kinase-related family protein (.1)
Potri.004G026200 42 / 5e-05 AT4G05200 573 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.004G025425 42 / 6e-05 AT4G21410 556 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Potri.004G024228 39 / 0.0007 AT4G23180 551 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G024101 38 / 0.001 AT4G23180 531 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G023788 38 / 0.001 AT4G23180 559 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10028049 pacid=23181106 polypeptide=Lus10028049 locus=Lus10028049.g ID=Lus10028049.BGIv1.0 annot-version=v1.0
ATGCATTCCTCGTCGAAACTAGCAATTGCAGTCTTGGTCATGGGTCTTATAACAAACATGCTCCTCGTCGTGGACGCCAAACTTCCTAACACCAATGTCC
TGATCAAGCCTGGTTGCGCTGAAAGATATGCGGGCAAGAGATTCGGCAATTACGTGACTCGTCTGTTGGATCTCCTGGTGGACGAAACGAAGAATGTGTA
CAGGAACAAGGACGGGAGTTACACGTACCGTCATAGCTACCCTGATATGGATTCGGGATCGGCTTATGGGGTGGGGAATTGTGGTAAGAAGCTTGAGAAG
TTGGATTGTTGGTCGTGTCTTCGAAATGCTAAGGACAAGGTCATGTCGGCTTGCTACAGAGCAGTCGGTGGTAACGTCACTCTTACGGACTGCTCCATCT
CCTTCAACCGGATTCCGTAA
AA sequence
>Lus10028049 pacid=23181106 polypeptide=Lus10028049 locus=Lus10028049.g ID=Lus10028049.BGIv1.0 annot-version=v1.0
MHSSSKLAIAVLVMGLITNMLLVVDAKLPNTNVLIKPGCAERYAGKRFGNYVTRLLDLLVDETKNVYRNKDGSYTYRHSYPDMDSGSAYGVGNCGKKLEK
LDCWSCLRNAKDKVMSACYRAVGGNVTLTDCSISFNRIP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G04520 PDLP2 plasmodesmata-located protein ... Lus10028049 0 1
Lus10014737 1.0 1.0000
AT3G04060 NAC ANAC046 NAC domain containing protein ... Lus10033699 2.0 1.0000
AT4G16195 Plant self-incompatibility pro... Lus10019768 2.4 1.0000
Lus10021773 2.8 1.0000
AT4G27170 SESA4, AT2S4 seed storage albumin 4 (.1) Lus10040395 3.2 1.0000
Lus10039552 3.5 1.0000
AT1G08510 FATB fatty acyl-ACP thioesterases B... Lus10035900 3.7 1.0000
Lus10019558 4.0 1.0000
AT5G51710 ATKEA5, KEA5 K+ efflux antiporter 5, ARABID... Lus10008000 4.2 0.9920
AT3G51560 Disease resistance protein (TI... Lus10029858 4.7 0.9780

Lus10028049 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.