Lus10028050 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008314 233 / 2e-80 ND /
Lus10035753 233 / 2e-79 ND /
Lus10008311 225 / 3e-77 ND 35 / 0.008
Lus10028053 228 / 3e-74 AT3G11080 120 / 8e-29 receptor like protein 35 (.1)
Lus10029619 121 / 3e-36 ND /
Lus10028049 120 / 8e-36 AT1G04520 38 / 9e-04 plasmodesmata-located protein 2 (.1)
Lus10003753 117 / 8e-35 ND /
Lus10029618 117 / 1e-34 ND /
Lus10042684 117 / 2e-34 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10028050 pacid=23181132 polypeptide=Lus10028050 locus=Lus10028050.g ID=Lus10028050.BGIv1.0 annot-version=v1.0
ATGGATCACGTGTCAAAATCGATGGTGGCAGTAATTCTGTTTATGGGTATTTTGAGTACGCTTATGGTTGATGCGAAACTTCCAAACAAGAGTATTATCA
GTGGGCCTGACTGTTCCGGTAGATCCTACGACGTATCTTACGACAAGAAAGTATTGCGCCTCATGGACATTTTTGTCGAGGAGACCAAGAACGTTCACAG
GGGTCATCACGTCGATTTTGAGTACAAACACAGTTTCCCCAATTCGGATAACGGATCCGTCAATGGTGGCGCTACTTGTGATAGGCACCTCTGGAAATTG
GATTGCTGGTCATGTCTTCTCACTGCGAAGAACAAAATTAACGACAATTGTGGGCGTACTCATAATGGTGAAATTAAGCTTAAAGATTGCTCCATTTGGT
TCAAGATGATCCAGTGA
AA sequence
>Lus10028050 pacid=23181132 polypeptide=Lus10028050 locus=Lus10028050.g ID=Lus10028050.BGIv1.0 annot-version=v1.0
MDHVSKSMVAVILFMGILSTLMVDAKLPNKSIISGPDCSGRSYDVSYDKKVLRLMDIFVEETKNVHRGHHVDFEYKHSFPNSDNGSVNGGATCDRHLWKL
DCWSCLLTAKNKINDNCGRTHNGEIKLKDCSIWFKMIQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10028050 0 1
Lus10017557 4.7 0.9212
AT3G47570 Leucine-rich repeat protein ki... Lus10037955 6.4 0.7992
Lus10005396 7.9 0.9152
AT3G20580 COBL10 COBRA-like protein 10 precurso... Lus10011160 8.2 0.7372
AT5G61730 ABCA9, ATATH11 ARABIDOPSIS THALIANA ABC2 HOMO... Lus10042172 8.6 0.7206
Lus10003840 9.6 0.9152
Lus10000784 11.1 0.9152
AT2G18370 Bifunctional inhibitor/lipid-t... Lus10001431 12.4 0.9152
Lus10022573 13.6 0.9152
Lus10006661 14.7 0.9152

Lus10028050 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.