Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008313 [exp] 77 / 5e-19 ND / Lus10028050 [exp] 65 / 2e-14 ND 36 / 0.004 Lus10035753 [exp] 65 / 5e-14 ND / Lus10008314 [exp] 64 / 7e-14 ND / Lus10028053 [exp] 65 / 2e-13 AT3G11080 120 / 8e-29 receptor like protein 35 (.1) Lus10008311 [exp] 47 / 2e-07 ND 35 / 0.008
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028051 pacid=23181240 polypeptide=Lus10028051 locus=Lus10028051.g ID=Lus10028051.BGIv1.0 annot-version=v1.0 ATGGATAATGTGTCAAAATCGACAATTGCAGTAATTCGGTTGCTCGTGATCATGAGTGTTTTGAGCGTAGTTGTTGACGGTGCCAAACTTCCTAACAAGA CCATCATCAGCGGCTCTGACTGTCCTGGCAAATCCAACAGCATGTCAGACGATAAGAAAGTGGTGTTGGGTGCCATCGACGTTTTCGCCAACGAGACCAC GAACGACCACCGCAAGGATGATCATGATATCGATTTTCGGTGCAAACACAGCTTCTTCCCCGCTTCGGATTTTGATAATCGCGTAAGGTTTCCAGCCTAC TGGAAGCATGTTAATGGCTGA
AA sequence Show only first row Show all	>Lus10028051 pacid=23181240 polypeptide=Lus10028051 locus=Lus10028051.g ID=Lus10028051.BGIv1.0 annot-version=v1.0 MDNVSKSTIAVIRLLVIMSVLSVVVDGAKLPNKTIISGSDCPGKSNSMSDDKKVVLGAIDVFANETTNDHRKDDHDIDFRCKHSFFPASDFDNRVRFPAY WKHVNG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10028051 [exp]	0	1
					Lus10003161 [exp]	9.2	0.8595
AT3G07970		QRT2	QUARTET 2, Pectin lyase-like s...		Lus10019711 [exp]	10.5	0.8474
AT4G37990		CAD-B2, ATCAD8,...	CINNAMYL-ALCOHOL DEHYDROGENASE...		Lus10038536 [exp]	12.8	0.8298
					Lus10033897 [exp]	18.8	0.8298
AT1G11920			Pectin lyase-like superfamily ...		Lus10011257 [exp]	24.0	0.7772
AT3G47440		TIP5;1	tonoplast intrinsic protein 5;...		Lus10031735 [exp]	27.8	0.7159
					Lus10034812 [exp]	29.4	0.8221
					Lus10003493 [exp]	31.5	0.8214
AT1G03700			Uncharacterised protein family...		Lus10011179 [exp]	31.7	0.8218
AT3G11920			glutaredoxin-related (.1)		Lus10029074 [exp]	33.7	0.7983

Compare expression of checked genes

Lus10028051 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.