Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59310 54 / 3e-10 LTP4 lipid transfer protein 4 (.1) AT3G51600 52 / 1e-09 LTP5 lipid transfer protein 5 (.1) AT5G59320 51 / 3e-09 LTP3 lipid transfer protein 3 (.1) AT2G15050 51 / 3e-09 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3) AT2G38540 51 / 3e-09 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT3G51590 51 / 4e-09 LTP12 lipid transfer protein 12 (.1) AT3G08770 50 / 9e-09 LTP6 lipid transfer protein 6 (.1.2) AT2G18370 50 / 9e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G62065 50 / 1e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G01870 49 / 2e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028002 [exp] 196 / 4e-66 AT5G59310 64 / 3e-14 lipid transfer protein 4 (.1) Lus10028003 [exp] 196 / 4e-66 AT5G59310 64 / 3e-14 lipid transfer protein 4 (.1) Lus10012383 [exp] 192 / 1e-64 AT5G59310 64 / 4e-14 lipid transfer protein 4 (.1) Lus10012384 [exp] 156 / 1e-50 AT5G59310 76 / 4e-19 lipid transfer protein 4 (.1) Lus10007280 [exp] 62 / 4e-13 AT5G59310 90 / 2e-24 lipid transfer protein 4 (.1) Lus10025148 [exp] 61 / 8e-13 AT5G01870 105 / 6e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10015279 [exp] 58 / 9e-12 AT5G59320 116 / 6e-35 lipid transfer protein 3 (.1) Lus10025230 [exp] 59 / 1e-11 AT3G08770 105 / 4e-30 lipid transfer protein 6 (.1.2) Lus10015278 [exp] 57 / 2e-11 AT5G59310 110 / 1e-32 lipid transfer protein 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G021900 [exp] 78 / 9e-20 AT3G08770 60 / 8e-13 lipid transfer protein 6 (.1.2) Potri.016G135700 [exp] 64 / 2e-14 AT5G59310 92 / 3e-25 lipid transfer protein 4 (.1) Potri.001G232700 [exp] 55 / 9e-11 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232900 [exp] 54 / 3e-10 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135500 [exp] 53 / 6e-10 AT5G59320 94 / 8e-26 lipid transfer protein 3 (.1) Potri.016G136000 [exp] 51 / 3e-09 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135800 [exp] 50 / 7e-09 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.004G086600 [exp] 50 / 1e-08 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G135400 [exp] 49 / 3e-08 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.009G025200 [exp] 48 / 6e-08 AT2G18370 86 / 6e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10028055 pacid=23181243 polypeptide=Lus10028055 locus=Lus10028055.g ID=Lus10028055.BGIv1.0 annot-version=v1.0 ATGAAGGGAGTGACTAACATGAATATCATTGTACCAGTTTTGATGTTGGCGTTGATCGTTATGGGCTCAACGACTAGCGTAACTGCAGAACAACCGGCAA TATGTCCGAGTGCATTGTTGAAGTTGCTGCCGTGCTTGACATACATCACAAAGCAAACACCTTCTCCATCTCCTCAGTGCTGCTCAAACGTAAAACTATT GAACGACGAGGCCAACACCACTCTTATCCGCCAACAGCTATGCACTTGCTTCAAGTCGGCGGCCATTGCCTATCACGTGGATCCACCAGTTGTCAAGGTT CTTCCTGATTTATGCCATGTTAATGTCCCCGTCCCCATCGATCCCACGATCGATTGCAGCAAGATTTCGATCTAG
AA sequence Show only first row Show all	>Lus10028055 pacid=23181243 polypeptide=Lus10028055 locus=Lus10028055.g ID=Lus10028055.BGIv1.0 annot-version=v1.0 MKGVTNMNIIVPVLMLALIVMGSTTSVTAEQPAICPSALLKLLPCLTYITKQTPSPSPQCCSNVKLLNDEANTTLIRQQLCTCFKSAAIAYHVDPPVVKV LPDLCHVNVPVPIDPTIDCSKISI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59310		LTP4	lipid transfer protein 4 (.1)		Lus10028055 [exp]	0	1

Compare expression of checked genes

Lus10028055 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.