Lus10028095 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008077 66 / 2e-13 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10028095 pacid=23181173 polypeptide=Lus10028095 locus=Lus10028095.g ID=Lus10028095.BGIv1.0 annot-version=v1.0
ATGAGATCTCTATTGGTCCGAGACCATAAGCTGCCAACATGGATCGAAGGTCTAGTAAGAGAGGCCAGTTTGGTAAATTCCAGAACCAGTCCTCCAACAC
TGGCTATTACAGATCAGTCCCTGAATAGTCAGAACTTTCAGATCAGTCAACTAACTTTCACAAAGTTCAGTCCAATCACCAAATTTCCAGAAACAGCACA
GAGGTCACTTAACTTTCAAGATTTACAGAATGGTCACCAGACCTTCAACAGTTGCACTTTGGCCAGTATTATTCTCCGACGAACTGCCTCGCCGGTGTCG
AGCTTTCCCAAGATTCCGGCGAGTTCCACCAATTTTGGAATCGCGGCGATCAGACATCAAGGTTCACTCCCGATCGTCCGTCGTCACTCCTTATCCACCG
ACGTGCCGGACGTGCCACCGATGACCCCGACCTCCAGCCACCGTGAAAGCTCGCCAACGCCACCTTCATTGCCCTCTCTCTCGATTCACCTGGACCTTCC
GCCGATGACTGTCGCCTTCTCCTTGATTGCTGTCACCAACGAGAAGCTGTCATAG
AA sequence
>Lus10028095 pacid=23181173 polypeptide=Lus10028095 locus=Lus10028095.g ID=Lus10028095.BGIv1.0 annot-version=v1.0
MRSLLVRDHKLPTWIEGLVREASLVNSRTSPPTLAITDQSLNSQNFQISQLTFTKFSPITKFPETAQRSLNFQDLQNGHQTFNSCTLASIILRRTASPVS
SFPKIPASSTNFGIAAIRHQGSLPIVRRHSLSTDVPDVPPMTPTSSHRESSPTPPSLPSLSIHLDLPPMTVAFSLIAVTNEKLS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10028095 0 1
Lus10000351 4.5 0.8838
Lus10002886 6.3 0.8838
AT5G55050 GDSL-like Lipase/Acylhydrolase... Lus10021543 7.7 0.8838
Lus10014748 8.9 0.8838
AT3G26880 Plant self-incompatibility pro... Lus10022631 10.0 0.8838
AT3G25050 XTH3 xyloglucan endotransglucosylas... Lus10022782 11.0 0.8838
AT3G62830 ATUXS2, UXS2, A... UDP-GLUCURONIC ACID DECARBOXYL... Lus10037499 11.3 0.6386
Lus10023108 11.8 0.8838
AT5G50790 SWEET10, AtSWEE... Nodulin MtN3 family protein (.... Lus10023249 12.6 0.8838
Lus10024321 13.4 0.8838

Lus10028095 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.