Lus10028125 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G18335 47 / 6e-07 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G132400 52 / 5e-09 AT4G18335 / unknown protein
PFAM info
Representative CDS sequence
>Lus10028125 pacid=23166525 polypeptide=Lus10028125 locus=Lus10028125.g ID=Lus10028125.BGIv1.0 annot-version=v1.0
ATGAACGTCAAGATCCTCATCAATCTCTTCTTCTCCGCCTTCATCTTCTTCTTCATCCTCCTCATCGTCTCCGCCATCGTCGCTCTTCCTCCCAAGTCGG
CCCACCAATCCACTCCACTCCCGCCTCGCCACATCATCGATCGTCATCACCACAGAACGCCGCCGCCGCCGACCACCAAGGAGGCCGCGGAGGCGCAGTA
CCAGGTTTTCCACATCAAGAACACCGCACCCTTCTTCTTGGACAGACAATCGCCAGCTGCAGGCCGCCCCCACCGTCCGACCAAGCCTAGTACTGCTGCT
CAACGGGCCAGGATCAACAGCAGCAAGAATAAGAAAAGAATCAAGACTGCGTCGTCTGGTTCCTCCTCCCCTGTCCCGATCAAGAAGAAGAAGAAGAAGA
CGAAGAAGGGATCCAGTACTGCTAGGCCTTTCTCGGTAATGCTTCCGAAGGGATTGGTTCCTCCGTCCGGATCTTCACCGGCCTGCCATAATGACAAACC
AGATACACAGCTCACTGTCGTTTACTCCTCCTGCCAGCAACCTTGA
AA sequence
>Lus10028125 pacid=23166525 polypeptide=Lus10028125 locus=Lus10028125.g ID=Lus10028125.BGIv1.0 annot-version=v1.0
MNVKILINLFFSAFIFFFILLIVSAIVALPPKSAHQSTPLPPRHIIDRHHHRTPPPPTTKEAAEAQYQVFHIKNTAPFFLDRQSPAAGRPHRPTKPSTAA
QRARINSSKNKKRIKTASSGSSSPVPIKKKKKKTKKGSSTARPFSVMLPKGLVPPSGSSPACHNDKPDTQLTVVYSSCQQP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G18335 unknown protein Lus10028125 0 1
AT3G25180 CYP82G1 cytochrome P450, family 82, su... Lus10016287 6.1 0.7349
AT4G12080 AT-hook ATAHL1, AHL1 AT-hook motif nuclear-localize... Lus10000177 9.4 0.6472
AT4G12080 AT-hook ATAHL1, AHL1 AT-hook motif nuclear-localize... Lus10000381 18.3 0.6739
AT1G08070 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSIN... Lus10001168 20.1 0.6380
Lus10036102 21.5 0.6961
AT3G24495 ATMSH7, MSH7, M... MUTS HOMOLOG 6-2, ARABIDOPSIS ... Lus10000017 28.6 0.6448
AT1G04110 SDD1 STOMATAL DENSITY AND DISTRIBUT... Lus10007046 36.5 0.6342
AT3G59650 mitochondrial ribosomal protei... Lus10022178 49.9 0.6519
Lus10030116 53.5 0.6274
AT1G70780 unknown protein Lus10009131 56.2 0.6223

Lus10028125 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.