Lus10028126 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G30000 115 / 3e-30 MNS3 alpha-mannosidase 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042830 234 / 1e-74 AT1G30000 846 / 0.0 alpha-mannosidase 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G132300 188 / 6e-57 AT1G30000 934 / 0.0 alpha-mannosidase 3 (.1)
PFAM info
Representative CDS sequence
>Lus10028126 pacid=23166448 polypeptide=Lus10028126 locus=Lus10028126.g ID=Lus10028126.BGIv1.0 annot-version=v1.0
ATGTCGAAATCTCTTCCCTATTCGACTAAAGATTTGAACTACGACAACGCCAAATTCCGCCAACGATCGGTCGTTAAGGTGCTAACGCAGTCCTTGCTCA
CCAAGAACAAGATGCGTGATTGTGCAAGCTTCAGTACGGGGAAGTTTCTTGCATTGTTGTTGATCTTTGGCTTCGGATATCTTATGTTAACACATTCAAG
TACTGCTCACTCTGTTTCAGTTAGACTAGCTGATAAGTTGAGTGTTAATGGAGAAGCTAAGAATGTCACAGGAGAAAATGCTCGGTTTGGGGGAATTTGG
AGGAAGCCACCAAGGCTCCCTCCTCGATTACCACCTGATGAGAAGGCCAGTCACAATGACAGTTCTAGTCATGAAGCAGCAAAGATTAATCTTGATTCGG
GATGGGTGGACAGACAAAAAAAAGTAAAGGAGGCTTTTATCTATGCTTGGTCTGGCTACAGAAAGTATGCGATGGGTATGACGAATTGA
AA sequence
>Lus10028126 pacid=23166448 polypeptide=Lus10028126 locus=Lus10028126.g ID=Lus10028126.BGIv1.0 annot-version=v1.0
MSKSLPYSTKDLNYDNAKFRQRSVVKVLTQSLLTKNKMRDCASFSTGKFLALLLIFGFGYLMLTHSSTAHSVSVRLADKLSVNGEAKNVTGENARFGGIW
RKPPRLPPRLPPDEKASHNDSSSHEAAKINLDSGWVDRQKKVKEAFIYAWSGYRKYAMGMTN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G30000 MNS3 alpha-mannosidase 3 (.1) Lus10028126 0 1
AT5G20490 XI-17, ATXIK, X... MYOSIN XI-17, MYOSIN XI K, Myo... Lus10021570 2.8 0.8633
AT5G07920 ATDGK1, DGK1 DIACYLGLYCEROL KINASE 1, diacy... Lus10034701 3.2 0.7834
AT1G03080 kinase interacting (KIP1-like)... Lus10022079 4.0 0.8367
AT4G12770 Chaperone DnaJ-domain superfam... Lus10016079 5.9 0.8115
AT5G20490 XI-17, ATXIK, X... MYOSIN XI-17, MYOSIN XI K, Myo... Lus10017160 7.9 0.8231
AT5G28850 Calcium-binding EF-hand family... Lus10027963 8.5 0.8175
AT1G22730 MA3 domain-containing protein ... Lus10012204 9.5 0.8054
AT2G19160 Core-2/I-branching beta-1,6-N-... Lus10006952 10.7 0.7520
AT2G19160 Core-2/I-branching beta-1,6-N-... Lus10025464 11.4 0.7290
AT2G41830 Uncharacterized protein (.1) Lus10042372 11.7 0.8056

Lus10028126 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.