Lus10028192 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G01710 236 / 5e-82 ARPC5, CRK CROOKED, ARP2/3 complex 16 kDa subunit (p16-Arc) (.1)
AT5G65274 229 / 7e-79 ARP2/3 complex 16 kDa subunit (p16-Arc) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042895 259 / 5e-90 AT4G01710 224 / 9e-76 CROOKED, ARP2/3 complex 16 kDa subunit (p16-Arc) (.1)
Lus10027941 113 / 5e-34 AT4G01710 89 / 1e-24 CROOKED, ARP2/3 complex 16 kDa subunit (p16-Arc) (.1)
Lus10012040 114 / 3e-32 AT4G01710 92 / 2e-23 CROOKED, ARP2/3 complex 16 kDa subunit (p16-Arc) (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G136500 235 / 3e-81 AT4G01710 224 / 4e-77 CROOKED, ARP2/3 complex 16 kDa subunit (p16-Arc) (.1)
Potri.014G045200 221 / 8e-76 AT4G01710 208 / 9e-71 CROOKED, ARP2/3 complex 16 kDa subunit (p16-Arc) (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Representative CDS sequence
>Lus10028192 pacid=23166507 polypeptide=Lus10028192 locus=Lus10028192.g ID=Lus10028192.BGIv1.0 annot-version=v1.0
ATGGCCGGTGCTGACGGATTTGTGGAATCAGAGAACGCCGAGGCAATCATTACCAGAATCGAACAGAAGTCTCGCAAGATCGAGAGCTTACTCAAACAGT
ACAAGCCAGTTGAAGCTCTCAAGACAGCGCTTGAAGGATCGCCTCCGAAGACCGGCGATGAGCGATGCAAGTCTGCGAATTGGATAGTGGTTCATAGAGC
GATTATGGCGATCAAAGACGTCGACGGAATGCTGACCTCATTGGACCCTGAGTATTACGATATCCTCATGAAGTATGTGTACAGAGGGTTGTCTACAGGA
GATCGGCCGACATGTGATCAGTGCCTGCGGATACACGAGAAATTGACAGCGAAGGCTGGACTGGGTTGCATTTTGCGCTCTCTTTCCGACACTGTAAATA
CTGTTTAA
AA sequence
>Lus10028192 pacid=23166507 polypeptide=Lus10028192 locus=Lus10028192.g ID=Lus10028192.BGIv1.0 annot-version=v1.0
MAGADGFVESENAEAIITRIEQKSRKIESLLKQYKPVEALKTALEGSPPKTGDERCKSANWIVVHRAIMAIKDVDGMLTSLDPEYYDILMKYVYRGLSTG
DRPTCDQCLRIHEKLTAKAGLGCILRSLSDTVNTV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G01710 ARPC5, CRK CROOKED, ARP2/3 complex 16 kDa... Lus10028192 0 1
AT3G13200 EMB2769 EMBRYO DEFECTIVE 2769, Cwf15 /... Lus10022566 2.4 0.9043
AT1G61780 postsynaptic protein-related (... Lus10007644 2.4 0.8847
AT2G19790 SNARE-like superfamily protein... Lus10035004 5.0 0.8758
AT2G23940 Protein of unknown function (D... Lus10041903 8.0 0.8732
AT4G31720 STG1, TAFII15, ... TBP-ASSOCIATED FACTOR 10, SALT... Lus10034375 10.6 0.8987
AT4G35980 unknown protein Lus10028436 11.7 0.8751
AT3G55920 Cyclophilin-like peptidyl-prol... Lus10030408 11.8 0.8743
AT4G22380 Ribosomal protein L7Ae/L30e/S1... Lus10025435 12.8 0.8685
AT3G63420 AGG1, ATAGG1 Ggamma-subunit 1 (.1.2) Lus10003092 13.5 0.8633
AT5G59140 BTB/POZ domain-containing prot... Lus10016485 13.9 0.8620

Lus10028192 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.