Lus10028199 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G35360 296 / 7e-100 CAC2 acetyl Co-enzyme a carboxylase biotin carboxylase subunit (.1.2.3)
AT1G03090 166 / 2e-48 MCCA methylcrotonyl-CoA carboxylase alpha chain, mitochondrial / 3-methylcrotonyl-CoA carboxylase 1 (MCCA) (.1), methylcrotonyl-CoA carboxylase alpha chain, mitochondrial / 3-methylcrotonyl-CoA carboxylase 1 (MCCA) (.2)
AT1G36180 67 / 3e-13 ACC2 acetyl-CoA carboxylase 2 (.1.2)
AT1G36160 66 / 7e-13 GSD1, PAS3, GK, EMB22, AT-ACC1, ACC1 PASTICCINO 3, GLOSSYHEAD 1, GURKE, EMBRYO DEFECTIVE 22, acetyl-CoA carboxylase 1 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042901 317 / 6e-109 AT5G35360 491 / 2e-171 acetyl Co-enzyme a carboxylase biotin carboxylase subunit (.1.2.3)
Lus10028196 319 / 6e-108 AT5G35360 892 / 0.0 acetyl Co-enzyme a carboxylase biotin carboxylase subunit (.1.2.3)
Lus10042899 315 / 1e-106 AT5G35360 821 / 0.0 acetyl Co-enzyme a carboxylase biotin carboxylase subunit (.1.2.3)
Lus10017534 313 / 7e-106 AT5G35360 892 / 0.0 acetyl Co-enzyme a carboxylase biotin carboxylase subunit (.1.2.3)
Lus10028753 306 / 3e-99 AT5G35360 888 / 0.0 acetyl Co-enzyme a carboxylase biotin carboxylase subunit (.1.2.3)
Lus10022078 166 / 1e-51 AT1G03090 405 / 4e-138 methylcrotonyl-CoA carboxylase alpha chain, mitochondrial / 3-methylcrotonyl-CoA carboxylase 1 (MCCA) (.1), methylcrotonyl-CoA carboxylase alpha chain, mitochondrial / 3-methylcrotonyl-CoA carboxylase 1 (MCCA) (.2)
Lus10042623 165 / 6e-48 AT1G03090 1064 / 0.0 methylcrotonyl-CoA carboxylase alpha chain, mitochondrial / 3-methylcrotonyl-CoA carboxylase 1 (MCCA) (.1), methylcrotonyl-CoA carboxylase alpha chain, mitochondrial / 3-methylcrotonyl-CoA carboxylase 1 (MCCA) (.2)
Lus10024748 68 / 1e-13 AT1G36160 2397 / 0.0 PASTICCINO 3, GLOSSYHEAD 1, GURKE, EMBRYO DEFECTIVE 22, acetyl-CoA carboxylase 1 (.1.2)
Lus10006934 65 / 2e-12 AT1G36160 3698 / 0.0 PASTICCINO 3, GLOSSYHEAD 1, GURKE, EMBRYO DEFECTIVE 22, acetyl-CoA carboxylase 1 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G146300 299 / 1e-100 AT5G35360 911 / 0.0 acetyl Co-enzyme a carboxylase biotin carboxylase subunit (.1.2.3)
Potri.006G078200 295 / 6e-99 AT5G35360 926 / 0.0 acetyl Co-enzyme a carboxylase biotin carboxylase subunit (.1.2.3)
Potri.005G213300 166 / 3e-48 AT1G03090 1099 / 0.0 methylcrotonyl-CoA carboxylase alpha chain, mitochondrial / 3-methylcrotonyl-CoA carboxylase 1 (MCCA) (.1), methylcrotonyl-CoA carboxylase alpha chain, mitochondrial / 3-methylcrotonyl-CoA carboxylase 1 (MCCA) (.2)
Potri.005G169100 67 / 4e-13 AT1G36160 3800 / 0.0 PASTICCINO 3, GLOSSYHEAD 1, GURKE, EMBRYO DEFECTIVE 22, acetyl-CoA carboxylase 1 (.1.2)
Potri.002G092700 66 / 6e-13 AT1G36160 3806 / 0.0 PASTICCINO 3, GLOSSYHEAD 1, GURKE, EMBRYO DEFECTIVE 22, acetyl-CoA carboxylase 1 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0179 ATP-grasp PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain
CL0483 PreATP-grasp PF00289 Biotin_carb_N Biotin carboxylase, N-terminal domain
Representative CDS sequence
>Lus10028199 pacid=23166453 polypeptide=Lus10028199 locus=Lus10028199.g ID=Lus10028199.BGIv1.0 annot-version=v1.0
ATGGCTGAAAAAATCCTGGTCGCAAACAAAGGAGAAATTGCTGTTCGTGTGATACGAACTGCCCACGAATTAGGAATACCATGTGTTGCTGTTTACTCAA
CCATCGACAAGGATGCCCTTCACGTAAAATTGGCTGATGAATCCGTTTGCATTGGTGAAGCACCAAGCAATCAGTCGTACTTAGTGATAGCCAATGTCTT
GTCTGCTGCTGTTAGTCGTGGATGTACCATGTTGCATCCTGGATATGGTTTCCTTTCTGAGAATGCCACATTTGTTGAAATGTGTCGAGCACACGGAATA
AATTTCATTGGACCAAATCCAGATAGCATCAAAACTATGGGAGATAAATCCACTGCCAGAGAAACAATGAAGAATGCAGGAGTTCCAACTGTTCCAGGAA
GTGATGGATTGTTGCAGAGCCGAGAGGAAGCAATTAGGCTGGCTGAAGATATAGGTTACCCTATGATGATCAAGCCAACCCAGATAGTGCCAGCAAACGG
GGTGGCCGCTTAA
AA sequence
>Lus10028199 pacid=23166453 polypeptide=Lus10028199 locus=Lus10028199.g ID=Lus10028199.BGIv1.0 annot-version=v1.0
MAEKILVANKGEIAVRVIRTAHELGIPCVAVYSTIDKDALHVKLADESVCIGEAPSNQSYLVIANVLSAAVSRGCTMLHPGYGFLSENATFVEMCRAHGI
NFIGPNPDSIKTMGDKSTARETMKNAGVPTVPGSDGLLQSREEAIRLAEDIGYPMMIKPTQIVPANGVAA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G35360 CAC2 acetyl Co-enzyme a carboxylase... Lus10028199 0 1
AT1G61010 CPSF73-I cleavage and polyadenylation s... Lus10015460 7.3 0.8193
AT3G20440 EMB2729, BE1 EMBRYO DEFECTIVE 2729, BRANCHI... Lus10003675 7.6 0.8763
AT2G17140 Pentatricopeptide repeat (PPR)... Lus10026545 21.4 0.8687
AT5G58450 Tetratricopeptide repeat (TPR)... Lus10026402 28.7 0.8504
AT5G61460 SMC6B, ATRAD18,... STRUCTURAL MAINTENANCE OF CHRO... Lus10038928 30.1 0.8348
AT5G24350 unknown protein Lus10007768 31.2 0.8494
AT3G50110 PTEN2B, ATPEN3 phosphatase and TENsin homolog... Lus10010266 37.1 0.8407
AT5G21160 LA RNA-binding protein (.1.2.3... Lus10041277 37.5 0.8313
AT3G62300 ATDUF7 DOMAIN OF UNKNOWN FUNCTION 724... Lus10000430 42.0 0.8370
ATCG00500 ATCG00500.1, AC... acetyl-CoA carboxylase carboxy... Lus10002473 44.0 0.8281

Lus10028199 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.