Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G44810 172 / 7e-54 DAD1 DEFECTIVE ANTHER DEHISCENCE 1, alpha/beta-Hydrolases superfamily protein (.1) AT4G16820 130 / 2e-36 PLA-I{beta]2 phospholipase A I beta 2, alpha/beta-Hydrolases superfamily protein (.1) AT2G30550 97 / 3e-24 alpha/beta-Hydrolases superfamily protein (.1.2) AT1G06800 89 / 2e-21 PLA-I{gamma}1 phospholipase A I gamma 1, alpha/beta-Hydrolases superfamily protein (.1.2) AT1G30370 82 / 3e-19 DLAH DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1) AT1G51440 79 / 4e-18 alpha/beta-Hydrolases superfamily protein (.1) AT1G05800 72 / 1e-15 DGL DONGLE, alpha/beta-Hydrolases superfamily protein (.1) AT2G31690 63 / 3e-12 alpha/beta-Hydrolases superfamily protein (.1) AT4G18550 52 / 2e-08 AtDSEL Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1) AT2G31100 50 / 1e-07 alpha/beta-Hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042914 [exp] 252 / 8e-84 AT2G44810 464 / 1e-163 DEFECTIVE ANTHER DEHISCENCE 1, alpha/beta-Hydrolases superfamily protein (.1) Lus10041165 [exp] 139 / 3e-40 AT2G44810 464 / 4e-164 DEFECTIVE ANTHER DEHISCENCE 1, alpha/beta-Hydrolases superfamily protein (.1) Lus10040158 [exp] 110 / 4e-29 AT4G16820 573 / 0.0 phospholipase A I beta 2, alpha/beta-Hydrolases superfamily protein (.1) Lus10004364 [exp] 110 / 5e-29 AT4G16820 587 / 0.0 phospholipase A I beta 2, alpha/beta-Hydrolases superfamily protein (.1) Lus10000600 [exp] 105 / 1e-28 AT4G16820 304 / 4e-101 phospholipase A I beta 2, alpha/beta-Hydrolases superfamily protein (.1) Lus10010997 [exp] 104 / 7e-27 AT4G16820 551 / 0.0 phospholipase A I beta 2, alpha/beta-Hydrolases superfamily protein (.1) Lus10038526 [exp] 91 / 3e-22 AT1G30370 539 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1) Lus10023280 [exp] 87 / 1e-20 AT1G30370 537 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1) Lus10038524 [exp] 87 / 1e-20 AT1G30370 526 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G047700 [exp] 192 / 2e-60 AT2G44810 491 / 9e-174 DEFECTIVE ANTHER DEHISCENCE 1, alpha/beta-Hydrolases superfamily protein (.1) Potri.014G047900 [exp] 177 / 7e-55 AT2G44810 557 / 0.0 DEFECTIVE ANTHER DEHISCENCE 1, alpha/beta-Hydrolases superfamily protein (.1) Potri.002G137900 [exp] 168 / 3e-51 AT2G44810 543 / 0.0 DEFECTIVE ANTHER DEHISCENCE 1, alpha/beta-Hydrolases superfamily protein (.1) Potri.003G081500 [exp] 113 / 4e-30 AT4G16820 558 / 0.0 phospholipase A I beta 2, alpha/beta-Hydrolases superfamily protein (.1) Potri.001G153100 [exp] 109 / 1e-28 AT4G16820 575 / 0.0 phospholipase A I beta 2, alpha/beta-Hydrolases superfamily protein (.1) Potri.005G218500 [exp] 89 / 3e-21 AT1G06800 652 / 0.0 phospholipase A I gamma 1, alpha/beta-Hydrolases superfamily protein (.1.2) Potri.002G044700 [exp] 87 / 1e-20 AT1G06800 662 / 0.0 phospholipase A I gamma 1, alpha/beta-Hydrolases superfamily protein (.1.2) Potri.001G263200 [exp] 85 / 4e-20 AT1G30370 607 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1) Potri.009G051900 [exp] 82 / 4e-19 AT1G51440 700 / 0.0 alpha/beta-Hydrolases superfamily protein (.1) Potri.009G057900 [exp] 78 / 1e-17 AT1G30370 626 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0028 [flax] [poplar] AB_hydrolase PF01764 [flax] [poplar] Lipase_3 Lipase (class 3)
Representative CDS sequence Show only first row Show all	>Lus10028210 pacid=23166511 polypeptide=Lus10028210 locus=Lus10028210.g ID=Lus10028210.BGIv1.0 annot-version=v1.0 ATGGTGACGGTTATGTCGTTTGGTGGTCCCCGGGTCGGGAACAGAAGCTTCAGGTGCCAGCTGGAGAGAGGTGGGATCAGGGTCCTGCGGATTGTCAACT CGGATGATGTCATCACAAAAGTGCCTGGCTTTGTTGTGGACAACGGCGAGGTGAGGTTGCCGATTAGGCTGCCGACATGGATAAAGAAGCACGTGGAAGC CACGCCTTGGGTGTATGCGGAGGTCGGTAAGGAGCTGAGGCTGAGCAGCAGGGAGTCGCCGTATATGAAGAATATGGATGTGGCCACGTGTCATGAGCTC AGCACGTACTTACACTTGGTGAATGGATTTGTGAGCCCCACGTGTCCATTTATAGCGACTACAATGAGTAAAGTATTATTCAATAAGCATCACAGAGAAA AATTGGGCTTTTGA
AA sequence Show only first row Show all	>Lus10028210 pacid=23166511 polypeptide=Lus10028210 locus=Lus10028210.g ID=Lus10028210.BGIv1.0 annot-version=v1.0 MVTVMSFGGPRVGNRSFRCQLERGGIRVLRIVNSDDVITKVPGFVVDNGEVRLPIRLPTWIKKHVEATPWVYAEVGKELRLSSRESPYMKNMDVATCHEL STYLHLVNGFVSPTCPFIATTMSKVLFNKHHREKLGF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G44810		DAD1	DEFECTIVE ANTHER DEHISCENCE 1,...		Lus10028210 [exp]	0	1
AT1G06520		ATGPAT1, GPAT1	glycerol-3-phosphate acyltrans...		Lus10000071 [exp]	1.0	0.9678
AT1G06520		ATGPAT1, GPAT1	glycerol-3-phosphate acyltrans...		Lus10000072 [exp]	2.0	0.9663
AT4G01950		ATGPAT3, GPAT3	glycerol-3-phosphate acyltrans...		Lus10029839 [exp]	2.4	0.9495
AT3G47110			Leucine-rich repeat protein ki...		Lus10038688 [exp]	3.0	0.8478
					Lus10037463 [exp]	4.0	0.9131
AT1G73880		UGT89B1	UDP-glucosyl transferase 89B1 ...		Lus10021719 [exp]	8.0	0.8775
AT1G75620			glyoxal oxidase-related protei...		Lus10024312 [exp]	8.7	0.9038
AT4G15800		RALFL33	ralf-like 33 (.1)		Lus10000502 [exp]	9.2	0.8867
AT1G19900			glyoxal oxidase-related protei...		Lus10012387 [exp]	10.0	0.8401
AT5G38940			RmlC-like cupins superfamily p...		Lus10038441 [exp]	12.8	0.6388

Compare expression of checked genes

Lus10028210 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.