Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G14210 117 / 1e-34 MADS AGL44, ANR1 ARABIDOPSIS NITRATE REGULATED 1, AGAMOUS-like 44 (.1) AT3G57230 111 / 2e-32 MADS AGL16 AGAMOUS-like 16 (.1.2) AT4G37940 106 / 2e-30 MADS AGL21 AGAMOUS-like 21 (.1) AT3G57390 102 / 1e-28 MADS AGL18 AGAMOUS-like 18 (.1.2) AT2G22630 99 / 2e-27 MADS AGL17 AGAMOUS-like 17 (.1) AT5G13790 98 / 5e-27 MADS AGL15 AGAMOUS-like 15 (.1) AT4G09960 96 / 9e-27 MADS AGL11, STK SEEDSTICK, AGAMOUS-like 11, K-box region and MADS-box transcription factor family protein (.1.2.3.4) AT4G11880 96 / 2e-26 MADS AGL14 AGAMOUS-like 14 (.1) AT2G03710 94 / 5e-26 MADS AGL3, SEP4 SEPALLATA 4, AGAMOUS-like 3, K-box region and MADS-box transcription factor family protein (.1.2.3) AT4G18960 94 / 2e-25 MADS AG AGAMOUS, K-box region and MADS-box transcription factor family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042918 [exp] 120 / 3e-37 AT3G57230 117 / 5e-34 AGAMOUS-like 16 (.1.2) Lus10029556 [exp] 107 / 5e-32 AT3G57230 104 / 7e-29 AGAMOUS-like 16 (.1.2) Lus10020477 [exp] 102 / 1e-29 AT4G37940 195 / 4e-64 AGAMOUS-like 21 (.1) Lus10005325 [exp] 103 / 8e-29 AT5G13790 249 / 7e-83 AGAMOUS-like 15 (.1) Lus10039580 [exp] 102 / 2e-28 AT5G13790 246 / 2e-81 AGAMOUS-like 15 (.1) Lus10031665 [exp] 98 / 6e-28 AT5G62165 179 / 8e-58 FOREVER YOUNG FLOWER, AGAMOUS-like 42 (.1.2.3.4.5) Lus10036543 [exp] 95 / 7e-28 AT2G45660 120 / 6e-36 SUPPRESSOR OF OVEREXPRESSION OF CO 1, AGAMOUS-like 20 (.1) Lus10007100 [exp] 99 / 1e-27 AT3G57230 226 / 4e-75 AGAMOUS-like 16 (.1.2) Lus10006716 [exp] 97 / 4e-27 AT4G11880 160 / 5e-50 AGAMOUS-like 14 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G109601 [exp] 113 / 2e-33 AT3G57230 299 / 1e-103 AGAMOUS-like 16 (.1.2) Potri.005G150501 [exp] 112 / 2e-32 AT3G57230 322 / 8e-112 AGAMOUS-like 16 (.1.2) Potri.009G079000 [exp] 109 / 1e-31 AT4G37940 293 / 3e-101 AGAMOUS-like 21 (.1) Potri.001G284600 [exp] 107 / 8e-31 AT4G37940 272 / 7e-93 AGAMOUS-like 21 (.1) Potri.001G284301 [exp] 107 / 8e-31 AT4G37940 272 / 7e-93 AGAMOUS-like 21 (.1) Potri.006G048700 [exp] 105 / 9e-30 AT3G57390 219 / 2e-71 AGAMOUS-like 18 (.1.2) Potri.003G119700 [exp] 99 / 7e-28 AT4G11880 226 / 4e-75 AGAMOUS-like 14 (.1) Potri.019G077200 [exp] 97 / 6e-27 AT4G09960 274 / 5e-94 SEEDSTICK, AGAMOUS-like 11, K-box region and MADS-box transcription factor family protein (.1.2.3.4) Potri.009G055700 [exp] 97 / 8e-27 AT5G13790 241 / 9e-80 AGAMOUS-like 15 (.1) Potri.002G151700 [exp] 96 / 1e-26 AT2G45660 212 / 8e-70 SUPPRESSOR OF OVEREXPRESSION OF CO 1, AGAMOUS-like 20 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00319 [flax] [poplar] SRF-TF SRF-type transcription factor (DNA-binding and dimerisation domain)
Representative CDS sequence Show only first row Show all	>Lus10028214 pacid=23166445 polypeptide=Lus10028214 locus=Lus10028214.g ID=Lus10028214.BGIv1.0 annot-version=v1.0 ATGGGGAGAGGGAAAATTGTGATAAGGAGGATCGACAATTCGACGAGTAGGCAAGTGACTTTCTCCAAGCGGAGGAACGGACTTCTCAAGAAGGCCAAAG AGTTGGCAATCCTTTGCGATGCCGAAGTCGGAGTCATCATCTTCTCCAGCACCGGCAAACTCTACGATTTCTCCAGCTCCAGGTCACCTACCTAA
AA sequence Show only first row Show all	>Lus10028214 pacid=23166445 polypeptide=Lus10028214 locus=Lus10028214.g ID=Lus10028214.BGIv1.0 annot-version=v1.0 MGRGKIVIRRIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVIIFSSTGKLYDFSSSRSPT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G14210	MADS	AGL44, ANR1	ARABIDOPSIS NITRATE REGULATED ...		Lus10028214 [exp]	0	1
AT3G57230	MADS	AGL16	AGAMOUS-like 16 (.1.2)		Lus10028215 [exp]	1.7	0.9462
AT1G54650			Methyltransferase family prote...		Lus10006576 [exp]	2.0	0.9467
AT1G78780			pathogenesis-related family pr...		Lus10039018 [exp]	3.5	0.9462
AT1G63380			NAD(P)-binding Rossmann-fold s...		Lus10007038 [exp]	3.6	0.9522
AT1G66540			Cytochrome P450 superfamily pr...		Lus10032856 [exp]	4.9	0.9297
AT3G47570			Leucine-rich repeat protein ki...		Lus10010199 [exp]	6.2	0.9288
AT4G27870			Vacuolar iron transporter (VIT...		Lus10022771 [exp]	6.5	0.9427
AT2G38300	GARP		myb-like HTH transcriptional r...		Lus10012239 [exp]	8.4	0.9424
AT4G15560		AtCLA1, DXS, DX...	1-DEOXY-D-XYLULOSE 5-PHOSPHATE...		Lus10002663 [exp]	8.4	0.9316
AT5G19440			NAD(P)-binding Rossmann-fold s...		Lus10016388 [exp]	8.5	0.9344

Compare expression of checked genes

Lus10028214 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.