Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G65660 74 / 6e-18 hydroxyproline-rich glycoprotein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042927 [exp] 127 / 3e-39 AT5G65660 95 / 6e-26 hydroxyproline-rich glycoprotein family protein (.1) Lus10032818 [exp] 102 / 2e-29 AT5G65660 84 / 7e-22 hydroxyproline-rich glycoprotein family protein (.1) Lus10028221 [exp] 86 / 1e-22 AT5G65660 66 / 1e-14 hydroxyproline-rich glycoprotein family protein (.1) Lus10042928 [exp] 78 / 1e-19 AT5G65660 66 / 8e-15 hydroxyproline-rich glycoprotein family protein (.1) Lus10039633 [exp] 76 / 1e-18 AT5G65660 147 / 1e-46 hydroxyproline-rich glycoprotein family protein (.1) Lus10002158 [exp] 76 / 1e-18 AT5G65660 146 / 3e-46 hydroxyproline-rich glycoprotein family protein (.1) Lus10019240 [exp] 52 / 6e-09 AT5G10560 407 / 1e-133 Glycosyl hydrolase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G108100 [exp] 96 / 1e-26 AT5G65660 95 / 6e-26 hydroxyproline-rich glycoprotein family protein (.1) Potri.019G055500 [exp] 62 / 2e-13 AT5G65660 114 / 2e-33 hydroxyproline-rich glycoprotein family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028220 pacid=23166465 polypeptide=Lus10028220 locus=Lus10028220.g ID=Lus10028220.BGIv1.0 annot-version=v1.0 ATGGAGGAAGATGATCGCCCCATCATCGGCTTTCCTCTCGGATTTGCTCTTTTACTGCTCACTCTCATCACCATGAGTGGCGTCTTCATCTGCTGCCTTC ACTGGGATCGCCTCCGTTCCCTTTGGGACGTTACTACTACTACTGATGAAACCCACCATAAACCATCGCCTCCACAACTGAAAATGGGCAAGATGACGGG GGAGAGCCTGCCGGTGTTGATGCCAGGAGACCAATTGCCCAGATTCGTGGCCATGGCTTGTCCGTGCAAGAAGCCGATTCTAGAGACGATTCAAGTGCAA GTTCAGAAGCCGACAACCACTCTGTTTCCTGTCCCTCCTCTGTTTTAG
AA sequence Show only first row Show all	>Lus10028220 pacid=23166465 polypeptide=Lus10028220 locus=Lus10028220.g ID=Lus10028220.BGIv1.0 annot-version=v1.0 MEEDDRPIIGFPLGFALLLLTLITMSGVFICCLHWDRLRSLWDVTTTTDETHHKPSPPQLKMGKMTGESLPVLMPGDQLPRFVAMACPCKKPILETIQVQ VQKPTTTLFPVPPLF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G65660			hydroxyproline-rich glycoprote...		Lus10028220 [exp]	0	1
AT1G02400		ATGA2OX4, ATGA2...	DOWNSTREAM TARGET OF AGL15 1, ...		Lus10037816 [exp]	2.2	0.9634
AT5G05960			Bifunctional inhibitor/lipid-t...		Lus10004677 [exp]	3.2	0.9449
AT1G67910			unknown protein		Lus10023632 [exp]	4.9	0.9542
AT3G53200	MYB	ATMYB27	myb domain protein 27 (.1)		Lus10014415 [exp]	10.7	0.9495
AT3G46130	MYB	PFG3, ATMYB111 ...	myb domain protein 48 (.1.2.3....		Lus10005886 [exp]	11.7	0.9513
AT1G49770	bHLH	ZOU, RGE1, bHLH...	ZHOUPI, RETARDED GROWTH OF EMB...		Lus10018723 [exp]	12.4	0.9522
AT5G40230			nodulin MtN21 /EamA-like trans...		Lus10033412 [exp]	20.1	0.9433
AT5G48060			C2 calcium/lipid-binding plant...		Lus10015709 [exp]	20.2	0.9434
AT5G23750			Remorin family protein (.1.2)		Lus10001477 [exp]	21.2	0.9331
AT1G63800		UBC5	ubiquitin-conjugating enzyme 5...		Lus10036372 [exp]	21.6	0.9512

Compare expression of checked genes

Lus10028220 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.