Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G65660 49 / 4e-08 hydroxyproline-rich glycoprotein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042928 [exp] 146 / 1e-46 AT5G65660 66 / 8e-15 hydroxyproline-rich glycoprotein family protein (.1) Lus10028220 [exp] 90 / 2e-24 AT5G65660 100 / 3e-28 hydroxyproline-rich glycoprotein family protein (.1) Lus10042927 [exp] 82 / 4e-21 AT5G65660 95 / 6e-26 hydroxyproline-rich glycoprotein family protein (.1) Lus10032818 [exp] 77 / 3e-19 AT5G65660 84 / 7e-22 hydroxyproline-rich glycoprotein family protein (.1) Lus10002158 [exp] 61 / 1e-12 AT5G65660 146 / 3e-46 hydroxyproline-rich glycoprotein family protein (.1) Lus10039633 [exp] 55 / 1e-10 AT5G65660 147 / 1e-46 hydroxyproline-rich glycoprotein family protein (.1) Lus10019240 [exp] 53 / 4e-09 AT5G10560 407 / 1e-133 Glycosyl hydrolase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G108100 [exp] 75 / 2e-18 AT5G65660 95 / 6e-26 hydroxyproline-rich glycoprotein family protein (.1) Potri.019G055500 [exp] 61 / 1e-12 AT5G65660 114 / 2e-33 hydroxyproline-rich glycoprotein family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028221 pacid=23166526 polypeptide=Lus10028221 locus=Lus10028221.g ID=Lus10028221.BGIv1.0 annot-version=v1.0 ATGATGAATTTATACGAAGAAAACGAGAGGTCAGTGATGGGGGTACCTCTGGGATTAATTCTTCTGGTGGTGACTCTGTTAGCCATGTGTGGAGTCTTCA TCTGCTGCCTTTACTGGGATCGGATTCCTCTCCATGCTCCACCTACCCACCACAACAACAAACCATCCCCTCATCACCTGAAGGCGAGCATGGATAAAGT GGAAAGCTTGCCAGTGATGATGCCAGGGGACCAAGTCCCCAGCTTTATAGCCATGGCTTGTCCCTGCAAGCCGCCGGTGGCTTTGGATACCATTAATATT CACTTGGACAAACCTCCAATCGTTACATTTCCTGCAGCCCCTCCTCTGTTATAG
AA sequence Show only first row Show all	>Lus10028221 pacid=23166526 polypeptide=Lus10028221 locus=Lus10028221.g ID=Lus10028221.BGIv1.0 annot-version=v1.0 MMNLYEENERSVMGVPLGLILLVVTLLAMCGVFICCLYWDRIPLHAPPTHHNNKPSPHHLKASMDKVESLPVMMPGDQVPSFIAMACPCKPPVALDTINI HLDKPPIVTFPAAPPLL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G65660			hydroxyproline-rich glycoprote...		Lus10028221 [exp]	0	1
AT2G17820		AHK1, ATHK1	histidine kinase 1 (.1)		Lus10041891 [exp]	3.5	0.8897
AT1G13590		ATPSK1	phytosulfokine 1 precursor (.1...		Lus10030916 [exp]	5.9	0.8930
AT3G19200			unknown protein		Lus10014046 [exp]	7.1	0.8909
AT3G05640			Protein phosphatase 2C family ...		Lus10037709 [exp]	7.7	0.9063
AT3G06880			Transducin/WD40 repeat-like su...		Lus10017257 [exp]	10.5	0.9056
AT2G27550		ATC	centroradialis (.1)		Lus10043385 [exp]	12.2	0.8681
AT1G60790		TBL2	TRICHOME BIREFRINGENCE-LIKE 2,...		Lus10030590 [exp]	13.6	0.9000
AT4G09890			Protein of unknown function (D...		Lus10033529 [exp]	17.3	0.8718
AT3G19290	bZIP	AREB2, ABF4	ABA-RESPONSIVE ELEMENT BINDING...		Lus10014066 [exp]	17.8	0.9031
AT2G27550		ATC	centroradialis (.1)		Lus10019541 [exp]	20.2	0.8529

Compare expression of checked genes

Lus10028221 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.