Lus10028223 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042930 51 / 5e-08 AT5G49665 397 / 7e-129 Zinc finger (C3HC4-type RING finger) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G107902 41 / 0.0001 AT5G49665 675 / 0.0 Zinc finger (C3HC4-type RING finger) family protein (.1)
PFAM info
Representative CDS sequence
>Lus10028223 pacid=23166492 polypeptide=Lus10028223 locus=Lus10028223.g ID=Lus10028223.BGIv1.0 annot-version=v1.0
ATGGGTACTGGGTGGAGAAGAGCCTTTTGTACTACTGTACCTAGAGATAAGCACCTTCCCAATCCCACTAGTCCTCCTCCTCCAACTACTTCAACCCCCA
GGACGACTAAGAAGCTCTCTTTCTTCTCCTCCGGAACTAGCAGCAGTAGTAACCCTTCTACTCCTCGTCTCCGCCTCAGATCTCTTTCCAGTCCTTCTTT
GCGCTCCCGCCCTACTACTACTAGTTCATCAGCACCTAATGTCAATACTGATGACACTACTCCTACCCTCCATTGCAAGACTACTCATAATACTCCCAGA
GCAACAACCAAGACTCCTACTGCTACTCCCAAACCCAAACTCCCCTCCAATCCTTCTTCCCCTCGCTCTCCTCTCAAGCTCTCCCTCTTCAAGAACAGCT
TTAAGTTCAGGGTACGTGCGTAA
AA sequence
>Lus10028223 pacid=23166492 polypeptide=Lus10028223 locus=Lus10028223.g ID=Lus10028223.BGIv1.0 annot-version=v1.0
MGTGWRRAFCTTVPRDKHLPNPTSPPPPTTSTPRTTKKLSFFSSGTSSSSNPSTPRLRLRSLSSPSLRSRPTTTSSSAPNVNTDDTTPTLHCKTTHNTPR
ATTKTPTATPKPKLPSNPSSPRSPLKLSLFKNSFKFRVRA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G49665 Zinc finger (C3HC4-type RING f... Lus10028223 0 1
AT5G49665 Zinc finger (C3HC4-type RING f... Lus10028224 1.0 0.9587
AT5G49665 Zinc finger (C3HC4-type RING f... Lus10042930 1.4 0.9411
AT3G28040 Leucine-rich receptor-like pro... Lus10037276 1.7 0.9193
AT4G35230 BSK1 BR-signaling kinase 1 (.1) Lus10021823 4.0 0.9125
AT1G48480 RKL1 receptor-like kinase 1 (.1) Lus10031909 10.2 0.9002
AT3G18600 P-loop containing nucleoside t... Lus10009616 10.5 0.8949
AT3G26330 CYP71B37 "cytochrome P450, family 71, s... Lus10028926 10.8 0.8744
AT1G48480 RKL1 receptor-like kinase 1 (.1) Lus10031337 14.4 0.8899
AT4G34460 ELK4, AGB1, ATA... ERECTA-LIKE 4, GTP binding pro... Lus10042325 14.7 0.8761
AT5G12080 ATMSL10, MSL10 mechanosensitive channel of sm... Lus10011953 15.3 0.8657

Lus10028223 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.