Lus10028233 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10028233 pacid=23166481 polypeptide=Lus10028233 locus=Lus10028233.g ID=Lus10028233.BGIv1.0 annot-version=v1.0
ATGCCACATGTGCATCATATATACTTCTCCGCTCAAACTAGAGAACAAAAATTCGCCCCCAAATTCTCCCGATCCTCTCCGCTGCGGCCGGCTTCGTCTA
CGCCAACGCTACTGATTGCTCCCCTCACTAACTGCTCTCCCTCCAACGCCTCCTCCATCCCCTCACTATGCAGATTCCCTCCCCCCTTCTCCATTTACAA
TCTATTCAATCCTCACTCCTCTGTTGCCGCCGATGCAGTCTCGGACCTAGATCTGCTCTGCTTCCAGATCTTCCGGATGAATAAGCCTACGTTTCTCAAT
TTCCCACACCAAGTGAATAGAAGCTTATTAGGGGGGACTAATCAAGGGAGGGGAAACAAGTTTACGAGTCCAGAAGGGGATGAAGGAGACGCTTGA
AA sequence
>Lus10028233 pacid=23166481 polypeptide=Lus10028233 locus=Lus10028233.g ID=Lus10028233.BGIv1.0 annot-version=v1.0
MPHVHHIYFSAQTREQKFAPKFSRSSPLRPASSTPTLLIAPLTNCSPSNASSIPSLCRFPPPFSIYNLFNPHSSVAADAVSDLDLLCFQIFRMNKPTFLN
FPHQVNRSLLGGTNQGRGNKFTSPEGDEGDA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10028233 0 1
AT2G27930 PLATZ transcription factor fam... Lus10036044 3.3 0.9111
AT5G19580 glyoxal oxidase-related protei... Lus10043230 5.7 0.8916
AT5G05090 GARP Homeodomain-like superfamily p... Lus10027291 6.7 0.8487
Lus10000400 7.3 0.8815
AT1G75490 AP2_ERF DREB2D Integrase-type DNA-binding sup... Lus10006127 7.9 0.7806
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10029390 8.5 0.8815
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10029913 9.5 0.8815
AT5G18460 Protein of Unknown Function (D... Lus10006860 10.4 0.8815
AT1G12630 AP2_ERF Integrase-type DNA-binding sup... Lus10027413 10.5 0.8730
AT2G29110 ATGLR2.8 glutamate receptor 2.8 (.1) Lus10026877 11.2 0.8815

Lus10028233 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.