Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G17870 87 / 1e-23 PSRP6 plastid-specific 50S ribosomal protein 6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007237 [exp] 158 / 2e-51 AT5G17870 96 / 5e-27 plastid-specific 50S ribosomal protein 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G112500 [exp] 107 / 4e-31 AT5G17870 93 / 9e-26 plastid-specific 50S ribosomal protein 6 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028238 pacid=23166456 polypeptide=Lus10028238 locus=Lus10028238.g ID=Lus10028238.BGIv1.0 annot-version=v1.0 ATGGCGATGTCCTCTATTTTGGGTTCTCCCTTGCTCCTTCCGAAATCATCACCTGCAGCACCCACCTTCAAACCCTTCACCGGAGTCACTCAACTGAAGC CACCGACTAGCGGTGGTTGTGGCGGGTTAACGATAGAATGCTCATCGAGGCCGCAGAAGAAGGCGACGGCTCACCATAGGAAGACAAGGCCAAGGAAAAG CCAGCCGTGGGATATTAAGCGGACACCCACCGTTTACCCGCAACTGCCCGAGCTTCCTCCTGACTGGACCCTAGTCTCGGCCGCAGATGTCGGTGATGCT GATGCTGGTGCTGCCGTTGAGACTGCTCTGGTTTCTGCTTCTTAG
AA sequence Show only first row Show all	>Lus10028238 pacid=23166456 polypeptide=Lus10028238 locus=Lus10028238.g ID=Lus10028238.BGIv1.0 annot-version=v1.0 MAMSSILGSPLLLPKSSPAAPTFKPFTGVTQLKPPTSGGCGGLTIECSSRPQKKATAHHRKTRPRKSQPWDIKRTPTVYPQLPELPPDWTLVSAADVGDA DAGAAVETALVSAS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G17870		PSRP6	plastid-specific 50S ribosomal...		Lus10028238 [exp]	0	1
AT5G17870		PSRP6	plastid-specific 50S ribosomal...		Lus10007237 [exp]	1.0	0.9485
AT3G20680			Domain of unknown function (DU...		Lus10006344 [exp]	2.4	0.9064
AT2G23670		YCF37	homolog of Synechocystis YCF37...		Lus10016781 [exp]	4.2	0.9096
AT5G13510		EMB3136	EMBRYO DEFECTIVE 3136, Ribosom...		Lus10001982 [exp]	4.7	0.9157
AT4G20360		AtRab8D, AtRABE...	RAB GTPase homolog E1B (.1)		Lus10041946 [exp]	7.1	0.9091
AT3G27850		RPL12-C	ribosomal protein L12-C (.1)		Lus10022261 [exp]	7.7	0.9094
AT2G33800		EMB3113	EMBRYO DEFECTIVE 3113, Ribosom...		Lus10015317 [exp]	9.5	0.9060
AT5G51110			Transcriptional coactivator/pt...		Lus10014182 [exp]	13.7	0.8990
AT5G16710		DHAR3	dehydroascorbate reductase 1 (...		Lus10028510 [exp]	15.5	0.8984
AT2G36000		EMB3114	EMBRYO DEFECTIVE 3114, Mitocho...		Lus10016971 [exp]	16.1	0.8992

Compare expression of checked genes

Lus10028238 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.