Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G10030 165 / 5e-54 ERG28 homolog of yeast ergosterol28 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007238 [exp] 227 / 1e-78 AT1G10030 162 / 4e-53 homolog of yeast ergosterol28 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G112700 [exp] 171 / 2e-56 AT1G10030 197 / 2e-66 homolog of yeast ergosterol28 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03694 [flax] [poplar] Erg28 Erg28 like protein
Representative CDS sequence Show only first row Show all	>Lus10028239 pacid=23166387 polypeptide=Lus10028239 locus=Lus10028239.g ID=Lus10028239.BGIv1.0 annot-version=v1.0 ATGGAGGCGTTAGGATGGTGGCTAATGCTCGTAGGATCGCTCCGTTTAGCTTCCGTCTGGTTCGGTTTCTTCAACATTCCCAGGCTTAGGTCCGGCGTCT ACGGCAAAGCCCCCATGACTGCAGTACATGGAAGGACATTTGCAATCTGGACACTGGTGACTTGCACTCTATGTTATACGTGTGCATTCAACCTTGATAA CAAGCCACTTTATTTGGTGACCTTGTTATCATTCATATATGCGCTTCTTCATTTCGTGACTGAAACACTTATCTATCAGTCGATGAGCATTGCTAACTTG GCAACTGTAAGCATCTTTGCAGGTAAGACTGTTGCCTTTTATCTGCTTTGA
AA sequence Show only first row Show all	>Lus10028239 pacid=23166387 polypeptide=Lus10028239 locus=Lus10028239.g ID=Lus10028239.BGIv1.0 annot-version=v1.0 MEALGWWLMLVGSLRLASVWFGFFNIPRLRSGVYGKAPMTAVHGRTFAIWTLVTCTLCYTCAFNLDNKPLYLVTLLSFIYALLHFVTETLIYQSMSIANL ATVSIFAGKTVAFYLL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G10030		ERG28	homolog of yeast ergosterol28 ...		Lus10028239 [exp]	0	1
AT2G43870			Pectin lyase-like superfamily ...		Lus10002126 [exp]	42.6	0.7866
AT2G35930		PUB23	plant U-box 23 (.1)		Lus10013352 [exp]	44.8	0.7890
AT2G17080			Arabidopsis protein of unknown...		Lus10023954 [exp]	53.4	0.7476
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10010698 [exp]	84.0	0.7383
AT5G32470			Haem oxygenase-like, multi-hel...		Lus10027948 [exp]	92.1	0.7505
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10005361 [exp]	98.7	0.7284
AT3G08900		RGP3	reversibly glycosylated polype...		Lus10036970 [exp]	108.6	0.7515
AT5G46230			Protein of unknown function, D...		Lus10001891 [exp]	135.6	0.7350
					Lus10026703 [exp]	181.0	0.7143
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Lus10012002 [exp]	237.7	0.7069

Compare expression of checked genes

Lus10028239 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.