Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G150300 [exp] 69 / 2e-17 ND / Potri.007G034000 [exp] 59 / 4e-13 ND / Potri.005G130750 [exp] 58 / 6e-13 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028245 pacid=23166398 polypeptide=Lus10028245 locus=Lus10028245.g ID=Lus10028245.BGIv1.0 annot-version=v1.0 ATGTGTTACGAGGTGAAGTGCTCAAGTTGCGGGAAGACAAGCTGGGGAGGATGCGGAAAGCATGTCCAGTCAGTTTACGAAAAGGTCCCTGAACCTCAAC GCTGTCTCTGCAAGGCTTGGCCCGGTGTCATCGTCGTCGACTCCACCAACCCCACCGCTCCGGCCGCCCAGACTACGACTACTTCTTCTCCTTCATCTTC CCGGTGCACCATCATGTGA
AA sequence Show only first row Show all	>Lus10028245 pacid=23166398 polypeptide=Lus10028245 locus=Lus10028245.g ID=Lus10028245.BGIv1.0 annot-version=v1.0 MCYEVKCSSCGKTSWGGCGKHVQSVYEKVPEPQRCLCKAWPGVIVVDSTNPTAPAAQTTTTSSPSSSRCTIM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10028245 [exp]	0	1
AT2G02960			RING/FYVE/PHD zinc finger supe...		Lus10030472 [exp]	2.4	0.8225
AT5G53130		ATCNGC1, CNGC1	CYCLIC NUCLEOTIDE-GATED CHANNE...		Lus10019014 [exp]	6.3	0.7751
AT3G02130		TOAD2, RPK2, CL...	TOADSTOOL 2, clv3 peptide inse...		Lus10037083 [exp]	7.0	0.7789
AT5G57580			Calmodulin-binding protein (.1...		Lus10011248 [exp]	8.8	0.7824
AT3G48890		MSBP2, ATMP2, A...	MEMBRANE STEROID BINDING PROTE...		Lus10014988 [exp]	16.9	0.7750
AT1G19660			Wound-responsive family protei...		Lus10007390 [exp]	17.5	0.7705
AT2G41480			Peroxidase superfamily protein...		Lus10007052 [exp]	19.2	0.7590
AT5G25930			Protein kinase family protein ...		Lus10006028 [exp]	27.0	0.7909
AT2G02960			RING/FYVE/PHD zinc finger supe...		Lus10012826 [exp]	27.2	0.7681
AT1G70420			Protein of unknown function (D...		Lus10030876 [exp]	27.7	0.7850

Compare expression of checked genes

Lus10028245 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.