Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G41880 207 / 3e-71 Ribosomal protein L35Ae family protein (.1) AT3G55750 207 / 6e-71 Ribosomal protein L35Ae family protein (.1) AT1G74270 207 / 7e-71 Ribosomal protein L35Ae family protein (.1) AT1G07070 206 / 8e-71 Ribosomal protein L35Ae family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040235 [exp] 228 / 2e-79 AT1G41880 207 / 7e-71 Ribosomal protein L35Ae family protein (.1) Lus10035539 [exp] 215 / 3e-74 AT1G74270 215 / 4e-74 Ribosomal protein L35Ae family protein (.1) Lus10027754 [exp] 191 / 4e-64 AT1G74270 196 / 7e-66 Ribosomal protein L35Ae family protein (.1) Lus10021121 [exp] 189 / 9e-63 AT1G07070 197 / 6e-66 Ribosomal protein L35Ae family protein (.1) Lus10017188 [exp] 156 / 2e-45 AT2G38010 1100 / 0.0 Neutral/alkaline non-lysosomal ceramidase (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G194200 [exp] 211 / 2e-72 AT1G07070 219 / 8e-76 Ribosomal protein L35Ae family protein (.1) Potri.008G059400 [exp] 210 / 4e-72 AT1G74270 216 / 1e-74 Ribosomal protein L35Ae family protein (.1) Potri.008G063200 [exp] 209 / 5e-72 AT1G07070 216 / 2e-74 Ribosomal protein L35Ae family protein (.1) Potri.010G199400 [exp] 208 / 2e-71 AT1G07070 214 / 1e-73 Ribosomal protein L35Ae family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0575 [flax] [poplar] EFTPs PF01247 [flax] [poplar] Ribosomal_L35Ae Ribosomal protein L35Ae
Representative CDS sequence Show only first row Show all	>Lus10028254 pacid=23166553 polypeptide=Lus10028254 locus=Lus10028254.g ID=Lus10028254.BGIv1.0 annot-version=v1.0 ATGAAGGAACGCCAAGGAGAACGCGTCAGACTCTACGTCCGAGGAACTATCCTTGGTTACAAGAGGTCTAAAGCGAACCAATACCCAAACACCTCACTGA TCCAGATTGAGGGAGTGAACACCAAGGAAGAAGTTGCATGGTATGCTGGAAAGAAGCTTGCTTACATCTACAAGGCTAAGGTGAAGACTAATGGATCGCA CTATCGCTGCATCTGGGGCAAGGTCACTCGGCCTCACGGAAACAGTGGTGTTGTTAGAGCCAAGTTCACCTCTAACCTGCCTCCCAAGTCCATGGGAGAC AGAGTTAGAGTCATGATGTACCCCAGCAATATATAA
AA sequence Show only first row Show all	>Lus10028254 pacid=23166553 polypeptide=Lus10028254 locus=Lus10028254.g ID=Lus10028254.BGIv1.0 annot-version=v1.0 MKERQGERVRLYVRGTILGYKRSKANQYPNTSLIQIEGVNTKEEVAWYAGKKLAYIYKAKVKTNGSHYRCIWGKVTRPHGNSGVVRAKFTSNLPPKSMGD RVRVMMYPSNI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G41880			Ribosomal protein L35Ae family...		Lus10028254 [exp]	0	1
AT4G14320			Zinc-binding ribosomal protein...		Lus10010195 [exp]	1.4	0.9652
AT2G20450			Ribosomal protein L14 (.1)		Lus10021170 [exp]	1.7	0.9678
AT3G10090			Nucleic acid-binding, OB-fold-...		Lus10016222 [exp]	3.0	0.9451
AT3G52590		HAP4, ERD16, UB...	HAPLESS 4, EARLY-RESPONSIVE TO...		Lus10008873 [exp]	3.9	0.9616
AT2G30260		U2B''	U2 small nuclear ribonucleopro...		Lus10042240 [exp]	4.1	0.9352
AT5G27700			Ribosomal protein S21e (.1)		Lus10015173 [exp]	4.9	0.9577
AT5G02610			Ribosomal L29 family protein ...		Lus10019179 [exp]	5.9	0.9532
AT2G34480			Ribosomal protein L18ae/LX fam...		Lus10014035 [exp]	7.0	0.9507
AT4G18100			Ribosomal protein L32e (.1)		Lus10020410 [exp]	8.1	0.9509
AT2G46230			PIN domain-like family protein...		Lus10010134 [exp]	9.7	0.9316

Compare expression of checked genes

Lus10028254 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.