Lus10028293 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G02030 46 / 4e-06 F-box family protein (.1)
AT4G22430 45 / 9e-06 F-box family protein (.1)
AT3G26010 41 / 0.0003 Galactose oxidase/kelch repeat superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007302 142 / 2e-40 AT1G15680 49 / 4e-06 F-box family protein (.1)
Lus10016522 144 / 3e-40 AT2G37890 155 / 6e-42 Mitochondrial substrate carrier family protein (.1)
Lus10002769 132 / 2e-38 AT1G15680 64 / 2e-11 F-box family protein (.1)
Lus10003349 131 / 1e-35 AT1G46912 48 / 2e-05 F-box associated ubiquitination effector family protein (.1.2)
Lus10013987 130 / 3e-35 AT3G23950 59 / 1e-08 F-box family protein (.1)
Lus10040838 129 / 4e-35 AT3G23950 57 / 2e-08 F-box family protein (.1)
Lus10004928 119 / 2e-34 ND 39 / 5e-04
Lus10013986 119 / 2e-31 ND 55 / 7e-08
Lus10008162 111 / 3e-31 AT1G60370 48 / 5e-07 F-box and associated interaction domains-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G004800 64 / 3e-12 AT5G49610 65 / 3e-11 F-box family protein (.1)
Potri.011G000700 50 / 2e-07 AT3G15910 58 / 5e-09 unknown protein
Potri.009G132400 43 / 5e-05 ND /
Potri.007G027200 41 / 0.0002 AT5G07610 84 / 1e-17 F-box family protein (.1)
PFAM info
Representative CDS sequence
>Lus10028293 pacid=23166452 polypeptide=Lus10028293 locus=Lus10028293.g ID=Lus10028293.BGIv1.0 annot-version=v1.0
ATGGCGACCAACACCTCGAGTGCAAAGGAAACACCTCGGGGAAGTAGATATTGGAGGCGTCCCACACCAGTCGTCACTCTATCAATCTCCTCACTCAACA
AACGACGATCACGAATCAGTTCGATCACCGAGCTCGGTCACGATATTCTGGTAGAGATTCTAATCCGAAGCTTCCCATATCCAAAATCCGCCTGCCACTC
CAAAGCTGTCTCTAAGCAGTGGAGCTCCCTGATTTCCAGTCCCTGCTTCAATCGCCGTTTCGTCTCACACCACCAACAGAAGAGTATCAAGCTGCTTTAC
CGGCAGAATGAGCTGGTATCGGTGATCTCGAGCTTTCTTCCTCCCAATCTTAATAGAGTAGAAGGAGAGACTCTTCACGTTTTCGATTGCTTCAAGGACT
TGGTTTTATGCGGGTTTTGGGATGCAGATGACCGCAATCCGAAACCTATCAGATCGTACATGATCTGCAATCCGTTTACTCAGAAGTGGATGGCTCTTCC
GTTGGCACCTCCGTATAGTTCTTCGCTGAATCCCCTACCAGTTGCAAGTTAG
AA sequence
>Lus10028293 pacid=23166452 polypeptide=Lus10028293 locus=Lus10028293.g ID=Lus10028293.BGIv1.0 annot-version=v1.0
MATNTSSAKETPRGSRYWRRPTPVVTLSISSLNKRRSRISSITELGHDILVEILIRSFPYPKSACHSKAVSKQWSSLISSPCFNRRFVSHHQQKSIKLLY
RQNELVSVISSFLPPNLNRVEGETLHVFDCFKDLVLCGFWDADDRNPKPIRSYMICNPFTQKWMALPLAPPYSSSLNPLPVAS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G22430 F-box family protein (.1) Lus10028293 0 1
AT4G18340 Glycosyl hydrolase superfamily... Lus10023309 6.5 0.6890
AT4G16195 Plant self-incompatibility pro... Lus10017929 14.6 0.5981
AT4G18340 Glycosyl hydrolase superfamily... Lus10038501 15.2 0.6721
AT5G38435 SPH8 S-protein homologue 8 (.1) Lus10016168 16.3 0.5981
Lus10034545 17.8 0.5981
AT5G67090 Subtilisin-like serine endopep... Lus10002044 19.3 0.5981
AT1G29430 SAUR-like auxin-responsive pro... Lus10007059 20.6 0.5981
Lus10028981 29.1 0.5496
AT5G08350 GRAM domain-containing protein... Lus10040999 44.1 0.5963
AT5G20950 Glycosyl hydrolase family prot... Lus10018102 47.1 0.5738

Lus10028293 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.