Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G40110 229 / 5e-79 Yippee family putative zinc-binding protein (.1.2) AT3G11230 203 / 5e-69 Yippee family putative zinc-binding protein (.1.2) AT3G08990 185 / 7e-62 Yippee family putative zinc-binding protein (.1.2) AT3G55890 170 / 5e-56 Yippee family putative zinc-binding protein (.1) AT5G53940 162 / 9e-53 Yippee family putative zinc-binding protein (.1) AT4G27745 119 / 6e-36 Yippee family putative zinc-binding protein (.1) AT4G27740 93 / 2e-25 Yippee family putative zinc-binding protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040190 [exp] 262 / 3e-92 AT2G40110 228 / 1e-78 Yippee family putative zinc-binding protein (.1.2) Lus10035531 [exp] 177 / 2e-58 AT3G08990 174 / 2e-57 Yippee family putative zinc-binding protein (.1.2) Lus10027762 [exp] 176 / 3e-58 AT2G40110 173 / 4e-57 Yippee family putative zinc-binding protein (.1.2) Lus10015416 [exp] 147 / 8e-47 AT5G53940 169 / 1e-55 Yippee family putative zinc-binding protein (.1) Lus10013992 [exp] 145 / 3e-46 AT5G53940 157 / 1e-50 Yippee family putative zinc-binding protein (.1) Lus10007773 [exp] 122 / 5e-37 AT4G27745 186 / 7e-63 Yippee family putative zinc-binding protein (.1) Lus10033226 [exp] 120 / 3e-36 AT4G27745 194 / 6e-66 Yippee family putative zinc-binding protein (.1) Lus10000335 [exp] 120 / 3e-36 AT4G27745 195 / 2e-66 Yippee family putative zinc-binding protein (.1) Lus10023244 [exp] 107 / 5e-31 AT4G27740 124 / 2e-38 Yippee family putative zinc-binding protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G067100 [exp] 237 / 1e-81 AT2G40110 232 / 1e-79 Yippee family putative zinc-binding protein (.1.2) Potri.010G190000 [exp] 234 / 4e-81 AT2G40110 224 / 6e-77 Yippee family putative zinc-binding protein (.1.2) Potri.016G115000 [exp] 159 / 4e-51 AT3G11230 154 / 2e-49 Yippee family putative zinc-binding protein (.1.2) Potri.011G115700 [exp] 154 / 1e-49 AT5G53940 187 / 1e-62 Yippee family putative zinc-binding protein (.1) Potri.001G085400 [exp] 122 / 4e-37 AT4G27745 197 / 3e-67 Yippee family putative zinc-binding protein (.1) Potri.015G009200 [exp] 122 / 5e-37 AT4G27745 201 / 1e-68 Yippee family putative zinc-binding protein (.1) Potri.012G019100 [exp] 120 / 1e-36 AT4G27745 202 / 2e-69 Yippee family putative zinc-binding protein (.1) Potri.003G145400 [exp] 119 / 7e-36 AT4G27745 179 / 3e-60 Yippee family putative zinc-binding protein (.1) Potri.006G015500 [exp] 117 / 5e-35 AT3G08990 122 / 6e-37 Yippee family putative zinc-binding protein (.1.2) Potri.014G101600 [exp] 113 / 1e-33 AT4G27745 154 / 2e-50 Yippee family putative zinc-binding protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0080 [flax] [poplar] Beta-tent PF03226 [flax] [poplar] Yippee-Mis18 Yippee zinc-binding/DNA-binding /Mis18, centromere assembly
Representative CDS sequence Show only first row Show all	>Lus10028300 pacid=23166497 polypeptide=Lus10028300 locus=Lus10028300.g ID=Lus10028300.BGIv1.0 annot-version=v1.0 ATGGGGAGGCTGTTTGTGGTGAGTCTTGAAGGGAAGATCTATAGCTGCAAGCACTGTAGAACCCATCTTGCTCTTTCTGAAGATATTGTGTCAAAGTCCT TCCACTCCAGGCATGGGAAAGCTTATCTTTTCAGCAAAGTAGTGAACGTAACTATGGGAGAGAAAGAGGAGAGATTAATGATGACCGGAAAGCATACCGT TGCTGACATTTTCTGTGTCGGATGTGGATCAATTGTGGGCTGGAAATATGAGACTGCCCATGAAAAGAGCCAGAAGTACAAGGAAGGAAAATCTGTTCTT GAACGGTTTAAGGTGTCTGGCCCTGATGGGAGCAGTTACTGGGTGAATCATGAAGCTCATGTGGGTGGCAGTGATGCAGATGATGTTTGA
AA sequence Show only first row Show all	>Lus10028300 pacid=23166497 polypeptide=Lus10028300 locus=Lus10028300.g ID=Lus10028300.BGIv1.0 annot-version=v1.0 MGRLFVVSLEGKIYSCKHCRTHLALSEDIVSKSFHSRHGKAYLFSKVVNVTMGEKEERLMMTGKHTVADIFCVGCGSIVGWKYETAHEKSQKYKEGKSVL ERFKVSGPDGSSYWVNHEAHVGGSDADDV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G40110			Yippee family putative zinc-bi...		Lus10028300 [exp]	0	1
AT1G26670		VTI1B, ATVTI12,...	VESICAL TRANSPORT V-SNARE 12, ...		Lus10037141 [exp]	2.6	0.9098
AT5G09260		VPS20.2	vacuolar protein sorting-assoc...		Lus10015693 [exp]	9.8	0.8980
AT5G49710			unknown protein		Lus10015965 [exp]	23.1	0.9035
AT2G05630		ATG8D	Ubiquitin-like superfamily pro...		Lus10027186 [exp]	23.7	0.8925
AT5G18150			Methyltransferase-related prot...		Lus10020287 [exp]	27.4	0.8910
AT4G39870			TLD-domain containing nucleola...		Lus10041697 [exp]	29.4	0.8916
AT1G78895			Reticulon family protein (.1)		Lus10033352 [exp]	39.9	0.8863
AT2G38370			Plant protein of unknown funct...		Lus10009099 [exp]	40.0	0.8906
AT5G20090			Uncharacterised protein family...		Lus10025851 [exp]	43.2	0.8748
AT1G18720			Protein of unknown function (D...		Lus10036771 [exp]	44.0	0.8555

Compare expression of checked genes

Lus10028300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.