Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G50870 124 / 9e-35 GATA GATA18, HAN, MNP MONOPOLE, HANABA TANARU, GATA TRANSCRIPTION FACTOR 18, GATA type zinc finger transcription factor family protein (.1) AT4G36620 110 / 4e-30 GATA GATA19, HANL2 hanaba taranu like 2, GATA transcription factor 19 (.1) AT2G18380 86 / 7e-21 GATA GATA20, HANL1 hanaba taranu like 1, GATA transcription factor 20 (.1) AT5G56860 65 / 2e-12 GATA GATA21, GNC GATA, nitrate-inducible, carbon metabolism-involved, GATA TRANSCRIPTION FACTOR 21, GATA type zinc finger transcription factor family protein (.1) AT4G26150 65 / 2e-12 GATA GATA22, CGA1, GNL GNC-LIKE, GATA TRANSCRIPTION FACTOR 22, cytokinin-responsive gata factor 1 (.1) AT5G49300 62 / 2e-12 GATA GATA16 GATA transcription factor 16 (.1) AT5G26930 61 / 4e-12 GATA GATA23 GATA transcription factor 23 (.1) AT3G20750 61 / 1e-11 GATA GATA29 GATA transcription factor 29 (.1) AT1G08010 62 / 2e-11 GATA GATA11 GATA transcription factor 11 (.1.2) AT3G06740 59 / 2e-11 GATA GATA15 GATA transcription factor 15 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016849 [exp] 62 / 3e-12 AT3G06740 154 / 6e-49 GATA transcription factor 15 (.1) Lus10037721 [exp] 62 / 3e-12 AT3G06740 153 / 2e-48 GATA transcription factor 15 (.1) Lus10031464 [exp] 60 / 2e-11 AT3G24050 69 / 3e-15 GATA transcription factor 1 (.1) Lus10029863 [exp] 60 / 4e-11 AT4G16141 90 / 1e-22 GATA type zinc finger transcription factor family protein (.1) Lus10020684 [exp] 59 / 6e-11 AT4G16141 94 / 9e-24 GATA type zinc finger transcription factor family protein (.1) Lus10010027 [exp] 57 / 1e-10 AT5G49300 87 / 8e-23 GATA transcription factor 16 (.1) Lus10009227 [exp] 59 / 2e-10 AT3G54810 162 / 8e-47 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) Lus10037994 [exp] 59 / 3e-10 AT3G54810 160 / 6e-46 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) Lus10037572 [exp] 57 / 8e-10 AT4G32890 236 / 2e-76 GATA transcription factor 9 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G122700 [exp] 144 / 5e-43 AT3G50870 198 / 1e-62 MONOPOLE, HANABA TANARU, GATA TRANSCRIPTION FACTOR 18, GATA type zinc finger transcription factor family protein (.1) Potri.007G024500 [exp] 142 / 6e-42 AT3G50870 202 / 5e-64 MONOPOLE, HANABA TANARU, GATA TRANSCRIPTION FACTOR 18, GATA type zinc finger transcription factor family protein (.1) Potri.006G229200 [exp] 67 / 3e-13 AT4G26150 111 / 3e-28 GNC-LIKE, GATA TRANSCRIPTION FACTOR 22, cytokinin-responsive gata factor 1 (.1) Potri.008G213900 [exp] 62 / 1e-12 AT3G06740 126 / 4e-38 GATA transcription factor 15 (.1) Potri.005G020500 [exp] 62 / 3e-12 AT3G06740 67 / 1e-14 GATA transcription factor 15 (.1) Potri.010G001300 [exp] 62 / 4e-12 AT3G06740 135 / 2e-41 GATA transcription factor 15 (.1) Potri.010G223300 [exp] 64 / 5e-12 AT3G54810 148 / 8e-42 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) Potri.008G038900 [exp] 64 / 6e-12 AT3G54810 150 / 1e-42 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) Potri.018G053600 [exp] 63 / 7e-12 AT4G26150 75 / 4e-15 GNC-LIKE, GATA TRANSCRIPTION FACTOR 22, cytokinin-responsive gata factor 1 (.1) Potri.014G124400 [exp] 60 / 1e-11 AT5G49300 106 / 2e-30 GATA transcription factor 16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF00320 [flax] [poplar] GATA GATA zinc finger
Representative CDS sequence Show only first row Show all	>Lus10028301 pacid=23166185 polypeptide=Lus10028301 locus=Lus10028301.g ID=Lus10028301.BGIv1.0 annot-version=v1.0 ATGACGACCACAACAACAACCGTACATCCTCCTCCAAAAACAACAACCGCCGCTCTTCCGGTCACTACGTCGCAAACTTTTTCTGGGACAAACTTTTGCT GGGACATCCTCAAAGGCGGCTCCTCCTCTAATAATAATAAGTCAAACTCCCGTGGACCGGCCCACAACAATAATAATGATCCGACATTGCTGGCCCGTCG ATGCGCCAACTGCGACACCACCTCCACCCCTCTCTGGCGCAACGGCCCCCGTGGCCCCAAGTCACTATGCAACGCGTGTGGAATTCGGTTCAAGAAAGAG GAGAGGAGAGCAAGTGCAGCTGCTGCCGGTTCATCATCCGGCCCGACAATGGAACATCAGCAGTACTATGGATACGGCGGCGCAACATCATCATCATCAT CATCGTCGAGCAAGATGGGGTGTTACTCTCCAGCGGGGGAGTTCAGGTTCATTGATCACGACAGTAATGATTATGATCATCATCATCAAGTGATGTCCGA GCAGACAGCTGGAATTCCAAGCTTCCTTTCGTGGAGATTGAACATCACCGATAGACCCGCCCTCGTCCACGACTTCACCAGATAG
AA sequence Show only first row Show all	>Lus10028301 pacid=23166185 polypeptide=Lus10028301 locus=Lus10028301.g ID=Lus10028301.BGIv1.0 annot-version=v1.0 MTTTTTTVHPPPKTTTAALPVTTSQTFSGTNFCWDILKGGSSSNNNKSNSRGPAHNNNNDPTLLARRCANCDTTSTPLWRNGPRGPKSLCNACGIRFKKE ERRASAAAAGSSSGPTMEHQQYYGYGGATSSSSSSSSKMGCYSPAGEFRFIDHDSNDYDHHHQVMSEQTAGIPSFLSWRLNITDRPALVHDFTR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G50870	GATA	GATA18, HAN, MN...	MONOPOLE, HANABA TANARU, GATA ...		Lus10028301 [exp]	0	1
AT3G50870	GATA	GATA18, HAN, MN...	MONOPOLE, HANABA TANARU, GATA ...		Lus10041746 [exp]	1.0	0.9495
AT3G50530		CRK	CDPK-related kinase (.1.2)		Lus10009342 [exp]	3.5	0.8841
AT1G62050			Ankyrin repeat family protein ...		Lus10002942 [exp]	3.5	0.9080
AT2G27990	HD	PNF, BLH8	POUND-FOOLISH, BEL1-like homeo...		Lus10016110 [exp]	4.5	0.9141
AT1G62360	HD	WAM1, WAM, SHL,...	WALDMEISTER 1, WALDMEISTER, SH...		Lus10030003 [exp]	6.5	0.8988
AT5G03610			GDSL-like Lipase/Acylhydrolase...		Lus10035600 [exp]	6.7	0.8667
AT1G62050			Ankyrin repeat family protein ...		Lus10003524 [exp]	6.7	0.8925
AT5G62740		AtHIR4, ATHIR1	hypersensitive induced reactio...		Lus10007268 [exp]	7.1	0.8920
AT4G37750	AP2_ERF	DRG, CKC1, ANT	DRAGON, COMPLEMENTING A PROTEI...		Lus10007719 [exp]	7.2	0.9080
AT5G57480			P-loop containing nucleoside t...		Lus10025479 [exp]	7.3	0.8516

Compare expression of checked genes

Lus10028301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.