Lus10028311 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18250 223 / 3e-75 ATCOAD 4-phosphopantetheine adenylyltransferase (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041759 290 / 1e-101 AT2G18250 270 / 4e-94 4-phosphopantetheine adenylyltransferase (.1)
Lus10026004 248 / 5e-85 AT2G18250 267 / 2e-92 4-phosphopantetheine adenylyltransferase (.1)
Lus10014296 230 / 1e-77 AT2G18250 249 / 5e-85 4-phosphopantetheine adenylyltransferase (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G121200 217 / 5e-73 AT2G18250 268 / 6e-93 4-phosphopantetheine adenylyltransferase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0039 HUP PF01467 CTP_transf_like Cytidylyltransferase-like
Representative CDS sequence
>Lus10028311 pacid=23165980 polypeptide=Lus10028311 locus=Lus10028311.g ID=Lus10028311.BGIv1.0 annot-version=v1.0
ATGGCAGCTGAGGATGAAACGGCGGTCAACTACAAGATTTCCCCGCCAAACACGTACGGATCCGTGGTGCTCGGCGGCACGTTTGATCGGCTTCACGACG
GCCACCGCCTTTTCCTCAAGGCAGCAGCCGAGCTGGCTAAGGAAAGGGTCGTTATTGGAGTTTGCCACGGCCCTATGCTCACCAAAAAAAAGTTTGCAGA
CCTGATACAGCCTGTTGATCAAAGGGTGCAGAATGTTGAACACTTCATCAAGTCTATCAAGCCAGAGCTCCTGGTGCAAGCTGAACCAATCATTGATCCA
TATGGACCTTCAACTGTCCTCCAAGATTTGGAAGCTATAGTTGTTAGCAAAGAGACTGTACCAGGCGGCCTGGCAGTTAACAGGAAGAGAGCTGAGAAAG
GATTTTCACAGCTCAAGATTGAAGTTGTGGATCTAATTTCTGACGGATCCAGTGGAGAGAAGCTGAGTTCCTCAACTTTGAGGCAACTCGATGCCGAGAA
GGCTAAACAACAAGCAACATAG
AA sequence
>Lus10028311 pacid=23165980 polypeptide=Lus10028311 locus=Lus10028311.g ID=Lus10028311.BGIv1.0 annot-version=v1.0
MAAEDETAVNYKISPPNTYGSVVLGGTFDRLHDGHRLFLKAAAELAKERVVIGVCHGPMLTKKKFADLIQPVDQRVQNVEHFIKSIKPELLVQAEPIIDP
YGPSTVLQDLEAIVVSKETVPGGLAVNRKRAEKGFSQLKIEVVDLISDGSSGEKLSSSTLRQLDAEKAKQQAT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G18250 ATCOAD 4-phosphopantetheine adenylylt... Lus10028311 0 1
AT3G16990 Haem oxygenase-like, multi-hel... Lus10037751 4.7 0.9710
AT3G02040 AtGDPD1, SRG3 Glycerophosphodiester phosphod... Lus10032006 4.9 0.9689
AT1G35190 2-oxoglutarate (2OG) and Fe(II... Lus10043026 5.1 0.9704
AT4G13400 2-oxoglutarate (2OG) and Fe(II... Lus10033085 5.9 0.9645
AT5G53160 RCAR3, PYL8 PYR1-like 8, regulatory compon... Lus10039335 5.9 0.9661
AT5G47720 Thiolase family protein (.1.2.... Lus10039109 6.5 0.9703
AT3G60340 alpha/beta-Hydrolases superfam... Lus10004375 9.2 0.9660
AT2G24370 Protein kinase protein with ad... Lus10021596 10.6 0.9594
AT1G56090 Tetratricopeptide repeat (TPR)... Lus10031774 13.5 0.9537
AT3G15260 Protein phosphatase 2C family ... Lus10005405 14.1 0.9630

Lus10028311 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.