Lus10028323 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G66500 185 / 1e-55 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G03580 143 / 5e-39 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G13650 142 / 8e-39 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G13600 139 / 8e-38 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G49142 135 / 1e-36 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G28690 134 / 2e-36 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G24000 134 / 5e-36 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G63370 134 / 6e-36 OTP86 ORGANELLE TRANSCRIPT PROCESSING 86, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G49170 132 / 2e-35 EMB2261 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G33760 131 / 2e-35 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041770 354 / 1e-120 AT5G66500 510 / 6e-177 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10037362 142 / 4e-39 AT3G57430 477 / 9e-158 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10035788 143 / 5e-39 AT3G16610 636 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Lus10015308 141 / 5e-39 AT1G28690 632 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10025420 141 / 2e-38 AT1G28690 634 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10025490 137 / 2e-37 AT2G33760 734 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10040504 136 / 6e-37 AT3G13770 904 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10030125 134 / 9e-37 AT2G20540 618 / 0.0 mitochondrial editing factor 21 (.1)
Lus10008136 135 / 1e-36 AT5G39350 639 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G022500 247 / 2e-79 AT5G66500 582 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G054000 146 / 8e-41 AT1G28690 672 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.016G051300 146 / 1e-40 AT3G13770 908 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.003G006800 142 / 1e-38 AT3G16610 687 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Potri.013G058900 140 / 4e-38 AT4G13650 1282 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G043400 132 / 8e-36 AT2G33760 775 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.007G104700 132 / 2e-35 AT2G13600 834 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G005700 130 / 1e-34 AT3G49142 912 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G001200 130 / 1e-34 AT3G24000 798 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G322100 129 / 2e-34 AT3G26782 897 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10028323 pacid=23166108 polypeptide=Lus10028323 locus=Lus10028323.g ID=Lus10028323.BGIv1.0 annot-version=v1.0
ATGTTGGCCTCACTAGCATTCTTACTGCTTGTTCCGATCTCTGATCTTCGGACCGGGATGCAGGTTCACTGTGTAGCAATTCGTTACGGGTTTATTTCAC
AGACTCAATTGTGCAATGCATTGTTAGATATGTATGCCAAATGCGGCCGAATTTCAAAAGGTAGGTCAGTATTTGATAAGATCATTAGCAAAGATGTTGT
CTCTTGGACTACCATGATTGATGCATATGGAAAGCATGGCTACGGACTCGAAGCTCTCGAGTTGTTCAAAAAAATGGGAGAAGAAGAAGTAAATACGGTG
TCGCCAAATTCTGTAACTTTCCTTGCTATTCTATCAGCTTGTGGACATGCAGGGCTGGCAGGATGGATAGAAGATGCTTGGTCCTTGTACGATGATATGA
TTGAGCATGGAATTAGGCCTACAAGTGCAATCTGGGCTTCACTACTGAACGTTTGTAATCTCAACGAAGACGCTTCAAGAGGTGAGTTTGCAGCCAAGAA
TCTCTTGGCGTTGGAACTGAACAATCCCGGGATCAATGTGCTACTTTCGAATTTCTTTGCATCCATTGGGAGATGGGATGCTGTTGATAGCCTGAGAAGC
AACATGATGGATAAAGGCCTGTCGAAAGAGTCCGGAAGTAGTCGAGTCAGCCACCACATGTTTACAAGTTGA
AA sequence
>Lus10028323 pacid=23166108 polypeptide=Lus10028323 locus=Lus10028323.g ID=Lus10028323.BGIv1.0 annot-version=v1.0
MLASLAFLLLVPISDLRTGMQVHCVAIRYGFISQTQLCNALLDMYAKCGRISKGRSVFDKIISKDVVSWTTMIDAYGKHGYGLEALELFKKMGEEEVNTV
SPNSVTFLAILSACGHAGLAGWIEDAWSLYDDMIEHGIRPTSAIWASLLNVCNLNEDASRGEFAAKNLLALELNNPGINVLLSNFFASIGRWDAVDSLRS
NMMDKGLSKESGSSRVSHHMFTS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G66500 Tetratricopeptide repeat (TPR)... Lus10028323 0 1
AT2G47430 CKI1 CYTOKININ-INDEPENDENT 1, Signa... Lus10035114 7.5 0.5952
AT1G70460 AtPERK13, RHS10 proline-rich extensin-like rec... Lus10013013 35.5 0.5266
AT4G27460 Cystathionine beta-synthase (C... Lus10025651 37.3 0.5667
AT5G13930 ATCHS, TT4, CHS TRANSPARENT TESTA 4, CHALCONE ... Lus10011745 73.2 0.5130
AT5G58820 Subtilisin-like serine endopep... Lus10002245 80.8 0.5068
AT5G06920 FLA21 FASCICLIN-like arabinogalactan... Lus10016437 102.6 0.5128
AT2G19170 SLP3 subtilisin-like serine proteas... Lus10040146 114.9 0.5017
AT3G02210 COBL1 COBRA-like protein 1 precursor... Lus10033047 124.6 0.4866
AT1G17930 Aminotransferase-like, plant m... Lus10011644 134.6 0.5047
AT2G27610 Tetratricopeptide repeat (TPR)... Lus10020586 143.5 0.4810

Lus10028323 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.