Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G36470 87 / 1e-21 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) AT1G19640 49 / 1e-07 JMT jasmonic acid carboxyl methyltransferase (.1) AT3G21950 42 / 2e-05 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041776 [exp] 187 / 9e-60 AT4G36470 421 / 3e-147 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10024271 [exp] 60 / 1e-11 AT1G19640 315 / 2e-105 jasmonic acid carboxyl methyltransferase (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G021400 [exp] 92 / 2e-23 AT4G36470 469 / 4e-166 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.005G230100 [exp] 49 / 5e-08 AT1G19640 389 / 1e-134 jasmonic acid carboxyl methyltransferase (.1) Potri.014G168232 [exp] 45 / 5e-07 AT1G19640 114 / 1e-30 jasmonic acid carboxyl methyltransferase (.1) Potri.012G049900 [exp] 42 / 1e-05 AT1G15125 309 / 1e-103 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [flax] [poplar] NADP_Rossmann PF03492 [flax] [poplar] Methyltransf_7 SAM dependent carboxyl methyltransferase
Representative CDS sequence Show only first row Show all	>Lus10028330 pacid=23166146 polypeptide=Lus10028330 locus=Lus10028330.g ID=Lus10028330.BGIv1.0 annot-version=v1.0 ATGGCTACATCAAGGGTTGAGATTGAAGCTGAGATCGAGAACCAAGGCTTGTTTGAGTTGGAGAGGTTTGAGACATTTGGGGTTGATCATCAGTTGAAAT TTGATGAGGCTAAAGATAGTAGTAGCTTGGGAAGAGAAGTTGCAAGAACAGTTAGGAGTGTACAGGAATCAATGTTGTCTCGACACTTTGGGGATGGGTT GAGTTTGGACAGATTGTTTGACATCTTTGCTACCATGCTGGATGAAGAGTTTGCCATTGCTGAAATCAGGCCTGCTAACTTCATCCTAGTTCTTAGAAAA AATGAATATAACTATACTAGTAGGTTTTAG
AA sequence Show only first row Show all	>Lus10028330 pacid=23166146 polypeptide=Lus10028330 locus=Lus10028330.g ID=Lus10028330.BGIv1.0 annot-version=v1.0 MATSRVEIEAEIENQGLFELERFETFGVDHQLKFDEAKDSSSLGREVARTVRSVQESMLSRHFGDGLSLDRLFDIFATMLDEEFAIAEIRPANFILVLRK NEYNYTSRF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G36470			S-adenosyl-L-methionine-depend...		Lus10028330 [exp]	0	1
					Lus10009927 [exp]	2.2	0.9771
AT5G05340			Peroxidase superfamily protein...		Lus10030149 [exp]	3.7	0.9709
AT1G55570		SKS12	SKU5 similar 12 (.1)		Lus10021864 [exp]	5.3	0.9545
					Lus10039496 [exp]	5.5	0.9706
AT1G33400		TPR9	tetratricopeptide repeat 9, Te...		Lus10042464 [exp]	5.5	0.9590
					Lus10018837 [exp]	6.0	0.9634
					Lus10034352 [exp]	6.3	0.9632
AT1G14830		DRP1C, ADL5, AD...	DYNAMIN RELATED PROTEIN 1C, AR...		Lus10043352 [exp]	7.3	0.9440
AT4G33030		SQD1	sulfoquinovosyldiacylglycerol ...		Lus10032973 [exp]	8.3	0.9013
AT3G44900		ATCHX4	cation/H+ exchanger 4, cation/...		Lus10032621 [exp]	8.4	0.9433

Compare expression of checked genes

Lus10028330 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.