Lus10028331 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06330 42 / 5e-05 Heavy metal transport/detoxification superfamily protein (.1)
AT1G01490 39 / 0.001 Heavy metal transport/detoxification superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027524 62 / 2e-11 AT1G01490 100 / 2e-25 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10039286 57 / 1e-09 AT1G01490 97 / 2e-24 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10014967 51 / 5e-08 AT1G01490 100 / 9e-27 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10007455 51 / 1e-07 AT3G44480 98 / 1e-20 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10027523 45 / 4e-06 AT1G01490 77 / 3e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10022508 42 / 4e-05 AT4G39700 201 / 2e-67 Heavy metal transport/detoxification superfamily protein (.1)
Lus10016812 42 / 5e-05 AT4G39700 181 / 3e-59 Heavy metal transport/detoxification superfamily protein (.1)
Lus10016436 41 / 0.0001 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1)
Lus10019676 41 / 0.0001 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G120200 91 / 1e-23 AT3G05220 64 / 8e-13 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.007G021200 90 / 3e-23 AT3G05220 65 / 6e-13 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.018G148900 65 / 7e-14 AT1G01490 66 / 1e-14 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G079400 54 / 1e-09 AT5G37860 66 / 4e-14 Heavy metal transport/detoxification superfamily protein (.1)
Potri.002G032800 48 / 2e-07 AT3G05920 52 / 2e-09 Heavy metal transport/detoxification superfamily protein (.1)
Potri.005G230300 47 / 3e-07 AT1G01490 57 / 3e-11 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147500 44 / 6e-06 AT1G01490 91 / 4e-24 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.002G092200 43 / 2e-05 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1)
Potri.004G073000 42 / 4e-05 AT1G01490 96 / 5e-26 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.001G099500 42 / 5e-05 AT1G01490 105 / 2e-29 Heavy metal transport/detoxification superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00403 HMA Heavy-metal-associated domain
Representative CDS sequence
>Lus10028331 pacid=23166081 polypeptide=Lus10028331 locus=Lus10028331.g ID=Lus10028331.BGIv1.0 annot-version=v1.0
ATGCAGAGAACGGTGCTCAAGGTAGAAATCGATTGTGTGAAATGCAAAAAGAAGCTCCTGAAGGCTGTTTCTGGTGTCCATGGTGTGGACAAGATCGAAA
TCGACGAAGCAAAGGGAACACTCACCGTCACTGGGAATGCTGATCCGTACGAGGTAATTGTCTGGTCAAGGAAAACCGGGAAGCGCGTTGAAGTCGTGAG
CATTGGGCCGCCGCCGCCGAAACAACAGGAAACTGGTGCAGGGCAGCCGAAAAAACCTGACGACAAGAAATCTGCTGCTGGAGACGCTGGAGGAGGCGGA
GGAGGAGATGTAAAGAAGACTACTAGCGGCGGCGACCAGAGAAAAGGCGGCGGCGGTAATGGTGGGGAGGAAAAGAAAGCGGCAGAGCAGAAGGGGGAGA
AGGGGATGATGCAGAGTTGGCCATTGGTCAACCACCAGCACCACCACGACCCACTTAACTGTCCATATTGTCAAAGAATCGTTGTAGTTCCGATGACCAG
CTCCTCCTATGACCGTTACTACCACGATCACAACAACCCGTCTTGCTACATAATGTAA
AA sequence
>Lus10028331 pacid=23166081 polypeptide=Lus10028331 locus=Lus10028331.g ID=Lus10028331.BGIv1.0 annot-version=v1.0
MQRTVLKVEIDCVKCKKKLLKAVSGVHGVDKIEIDEAKGTLTVTGNADPYEVIVWSRKTGKRVEVVSIGPPPPKQQETGAGQPKKPDDKKSAAGDAGGGG
GGDVKKTTSGGDQRKGGGGNGGEEKKAAEQKGEKGMMQSWPLVNHQHHHDPLNCPYCQRIVVVPMTSSSYDRYYHDHNNPSCYIM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06330 Heavy metal transport/detoxifi... Lus10028331 0 1
AT5G67360 ARA12 Subtilase family protein (.1) Lus10006310 1.7 0.9282
AT4G01310 Ribosomal L5P family protein (... Lus10033169 5.5 0.8168
AT4G38380 MATE efflux family protein (.1... Lus10023944 8.9 0.8492
AT4G31880 unknown protein Lus10002307 9.5 0.8811
AT4G35040 bZIP bZIP19 Basic-leucine zipper (bZIP) tr... Lus10016368 11.2 0.7821
AT1G22340 ATUGT85A7 UDP-glucosyl transferase 85A7 ... Lus10011662 11.6 0.8686
AT4G14590 EMB2739 embryo defective 2739 (.1) Lus10009705 13.6 0.8367
AT1G50270 Pentatricopeptide repeat (PPR)... Lus10017351 22.4 0.7598
AT5G42230 SCPL41 serine carboxypeptidase-like 4... Lus10023444 23.8 0.8075
AT5G45650 subtilase family protein (.1) Lus10026062 26.1 0.8049

Lus10028331 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.