Lus10028336 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G36420 117 / 2e-33 Ribosomal protein L12 family protein (.1)
AT1G70190 98 / 1e-25 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2)
AT3G06040 84 / 3e-20 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3)
AT4G37660 77 / 5e-18 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
AT2G03130 64 / 1e-13 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
AT3G27850 53 / 7e-09 RPL12-C ribosomal protein L12-C (.1)
AT3G27830 53 / 7e-09 RPL12-A ribosomal protein L12-A (.1)
AT3G27840 45 / 7e-06 RPL12-B ribosomal protein L12-B (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041783 252 / 2e-86 AT4G36420 174 / 5e-56 Ribosomal protein L12 family protein (.1)
Lus10038367 105 / 4e-28 AT1G70190 243 / 3e-82 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2)
Lus10036228 104 / 4e-28 AT1G70190 238 / 3e-80 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2)
Lus10031756 93 / 1e-23 AT3G06040 202 / 2e-66 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3)
Lus10023839 91 / 6e-23 AT4G37660 155 / 1e-48 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
Lus10000093 91 / 6e-23 AT4G37660 155 / 1e-48 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
Lus10031180 90 / 1e-22 AT3G06040 202 / 2e-66 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3)
Lus10021011 90 / 2e-22 AT4G37660 157 / 3e-49 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
Lus10022261 59 / 4e-11 AT3G27850 178 / 4e-57 ribosomal protein L12-C (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G019100 151 / 1e-46 AT4G36420 127 / 2e-37 Ribosomal protein L12 family protein (.1)
Potri.003G074800 98 / 1e-25 AT1G70190 204 / 1e-66 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2)
Potri.015G077200 97 / 2e-25 AT3G06040 132 / 3e-39 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3)
Potri.004G224300 80 / 4e-19 AT4G37660 154 / 4e-48 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
Potri.001G346100 53 / 1e-08 AT3G27830 146 / 1e-44 ribosomal protein L12-A (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain
Representative CDS sequence
>Lus10028336 pacid=23166101 polypeptide=Lus10028336 locus=Lus10028336.g ID=Lus10028336.BGIv1.0 annot-version=v1.0
ATGTCAAAGTTCCGATTGATTTTACGGCCTTTGTGGCGGGATCGGCGAACCCTCGATCGGAGACCTGCGTTTACCCGCCAATTTGCTTCGGCAGCACAGG
ATTCGGTTCCGAAGGCGGCGCCATCGGAAAGGGTTTCGGAAATCGTGAACGAGATCTCAGGTTTAACTCTTCTGGAAGTCTCGGATCTCACCGAGGTTCT
GCGGACCAAGTTGGATATCAAGGAGATGCCTGTGATGGCCATGATGATGCCAGGTATGGGGTTCAGTGGGATGCCCGGAGGTGGAAGGGGAGCTGCCGCG
CCTTCTGCCAAAGGAGAGGAGAAGGCGGAAAAGACGGCGTTCGATTTGAAGCTAGATGGGTACGACGCGGCGGCGAAGATCAAGGTGATTAAGGAAGTTA
GGGCGTTTACGGATTTGGGGTTGAAAGAAGCGAAGGACTTGGTGGAGAAAGCTCCTACATTGTTGAAGAAAGGAGTGACGAAAGAAGAAGCTGAGAAGAT
TATTGCTAAGCTGAAGGAGGTTGGGGCCAAAGTTTCTATGGAGTGA
AA sequence
>Lus10028336 pacid=23166101 polypeptide=Lus10028336 locus=Lus10028336.g ID=Lus10028336.BGIv1.0 annot-version=v1.0
MSKFRLILRPLWRDRRTLDRRPAFTRQFASAAQDSVPKAAPSERVSEIVNEISGLTLLEVSDLTEVLRTKLDIKEMPVMAMMMPGMGFSGMPGGGRGAAA
PSAKGEEKAEKTAFDLKLDGYDAAAKIKVIKEVRAFTDLGLKEAKDLVEKAPTLLKKGVTKEEAEKIIAKLKEVGAKVSME

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G36420 Ribosomal protein L12 family p... Lus10028336 0 1
AT5G60340 P-loop containing nucleoside t... Lus10016525 2.4 0.8012
AT4G08460 Protein of unknown function (D... Lus10009772 9.3 0.7970
AT4G18905 Transducin/WD40 repeat-like su... Lus10015348 10.2 0.7623
AT4G36420 Ribosomal protein L12 family p... Lus10041783 12.6 0.7152
AT5G52840 NADH-ubiquinone oxidoreductase... Lus10014951 13.6 0.7568
AT3G06610 DNA-binding enhancer protein-r... Lus10037773 14.2 0.7934
AT3G56570 SET domain-containing protein ... Lus10026538 16.0 0.7034
AT3G53740 Ribosomal protein L36e family ... Lus10016501 17.3 0.7764
AT4G18040 LSP1, CUM1, AT.... eukaryotic translation Initiat... Lus10015247 17.5 0.7440
AT3G10090 Nucleic acid-binding, OB-fold-... Lus10029320 21.5 0.7445

Lus10028336 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.