Lus10028341 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G75440 250 / 8e-87 UBC16 ubiquitin-conjugating enzyme 16 (.1)
AT5G42990 242 / 1e-83 UBC18 ubiquitin-conjugating enzyme 18 (.1)
AT1G45050 240 / 6e-83 ATUBC2-1, UBC15 Arabidopsis thaliana ubiquitin-conjugating enzyme 15, Ubiquitin-conjugating enzyme family protein (.1)
AT4G36410 232 / 2e-79 UBC17 ubiquitin-conjugating enzyme 17 (.1)
AT5G41700 74 / 1e-17 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
AT3G08690 74 / 2e-17 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
AT2G16740 73 / 5e-17 UBC29 ubiquitin-conjugating enzyme 29 (.1)
AT5G53300 73 / 6e-17 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
AT5G56150 72 / 8e-17 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
AT1G78870 72 / 8e-17 UBC35 ,UBC13A UBIQUITIN CONJUGATING ENZYME 13A, ubiquitin-conjugating enzyme 35 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041791 227 / 3e-77 AT1G75440 246 / 9e-85 ubiquitin-conjugating enzyme 16 (.1)
Lus10032352 76 / 3e-18 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10033937 76 / 3e-18 AT5G53300 300 / 2e-106 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10009422 75 / 1e-17 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
Lus10028700 75 / 1e-17 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
Lus10027570 75 / 1e-17 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10038827 75 / 1e-17 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10014942 75 / 1e-17 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10039323 75 / 1e-17 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G030800 266 / 2e-93 AT5G42990 251 / 9e-87 ubiquitin-conjugating enzyme 18 (.1)
Potri.005G118600 263 / 4e-92 AT1G75440 296 / 1e-104 ubiquitin-conjugating enzyme 16 (.1)
Potri.007G018700 261 / 5e-91 AT1G75440 295 / 3e-104 ubiquitin-conjugating enzyme 16 (.1)
Potri.005G232100 252 / 2e-87 AT5G42990 256 / 1e-88 ubiquitin-conjugating enzyme 18 (.1)
Potri.001G094900 76 / 3e-18 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.012G033000 76 / 3e-18 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.015G023300 76 / 3e-18 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.008G053800 74 / 2e-17 AT5G59300 264 / 4e-91 ARABIDOPSIS THALIANA UBIQUITIN CARRIER PROTEIN 7, ubiquitin carrier protein 7 (.1)
Potri.019G131400 73 / 3e-17 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.016G138900 73 / 4e-17 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0208 UBC PF00179 UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence
>Lus10028341 pacid=23166107 polypeptide=Lus10028341 locus=Lus10028341.g ID=Lus10028341.BGIv1.0 annot-version=v1.0
ATGACCAGTTCCTCCGCCACCGCTCGCAAGGTCAATCCTCCCACTGGATTCAAACACAAAGTCACCGACAATCTCCAGAGGTGGGTGATTGAAGTAAATG
GAGCTCCTGGAACCCTCTATGCTAATGAAATGTACCAGCTCCAAGTTGATTTCCCTGAGCATTACCCAATGGAAGCTCCCCAGGTTATATTTCTTCACCC
AGCTCCACTGCACCCTCACATTTACAGCAATGGCCATATTTGTTTAGATATATTATACGATTCTTGGTCACCGGCTATGACTGTTAGTTCTGTGTGTATC
AGCATCCTTTCAATGCTGTCAAGCTCAACTGTTAAGCAACGCCCTGAAGACAATGATCGCTATGTGAAGAACTGCCGTAACGGAAGATCTCCGAAGGAGA
CCAGGTGGTGGTTCCATGACGACAAGGTGTAA
AA sequence
>Lus10028341 pacid=23166107 polypeptide=Lus10028341 locus=Lus10028341.g ID=Lus10028341.BGIv1.0 annot-version=v1.0
MTSSSATARKVNPPTGFKHKVTDNLQRWVIEVNGAPGTLYANEMYQLQVDFPEHYPMEAPQVIFLHPAPLHPHIYSNGHICLDILYDSWSPAMTVSSVCI
SILSMLSSSTVKQRPEDNDRYVKNCRNGRSPKETRWWFHDDKV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G75440 UBC16 ubiquitin-conjugating enzyme 1... Lus10028341 0 1
AT3G10850 GLY2, GLX2-2 GLYOXALASE 2-2, Metallo-hydrol... Lus10029086 2.4 0.8798
AT1G61780 postsynaptic protein-related (... Lus10007644 2.4 0.8808
AT1G15860 Domain of unknown function (DU... Lus10039198 14.8 0.8693
AT5G23540 Mov34/MPN/PAD-1 family protein... Lus10021746 17.5 0.8057
AT1G64230 UBC28 ubiquitin-conjugating enzyme 2... Lus10014942 19.1 0.8406
AT2G48030 DNAse I-like superfamily prote... Lus10029630 20.6 0.7844
AT5G35180 Protein of unknown function (D... Lus10019585 31.9 0.8223
AT2G25280 unknown protein Lus10001925 35.0 0.8131
AT1G04530 TPR4 tetratricopeptide repeat 4, Te... Lus10000257 38.7 0.8242
AT5G16110 unknown protein Lus10033560 46.3 0.8136

Lus10028341 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.