Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G51030 179 / 9e-60 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT5G42980 143 / 2e-45 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1) AT1G45145 143 / 2e-45 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1) AT1G19730 138 / 2e-43 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT3G08710 109 / 8e-32 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) AT5G39950 103 / 1e-29 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT3G17880 105 / 6e-28 ATHIP2, ATTDX HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) AT3G56420 95 / 8e-26 Thioredoxin superfamily protein (.1) AT1G59730 91 / 2e-24 ATH7 thioredoxin H-type 7 (.1) AT1G69880 85 / 5e-22 ATH8 thioredoxin H-type 8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041799 [exp] 237 / 1e-82 AT3G51030 182 / 8e-61 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10014277 [exp] 198 / 3e-67 AT3G51030 185 / 4e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10025979 [exp] 177 / 6e-59 AT3G51030 167 / 3e-55 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10024293 [exp] 155 / 4e-50 AT3G51030 162 / 4e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10000802 [exp] 152 / 5e-49 AT3G51030 165 / 5e-54 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10022727 [exp] 112 / 5e-33 AT3G08710 189 / 6e-63 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10014186 [exp] 112 / 8e-33 AT3G08710 192 / 3e-64 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10005258 [exp] 108 / 3e-31 AT5G39950 189 / 4e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10031334 [exp] 114 / 4e-31 AT3G17880 456 / 3e-160 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G018000 [exp] 178 / 4e-59 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.005G232700 [exp] 144 / 5e-46 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.002G030000 [exp] 143 / 2e-45 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.012G045000 [exp] 116 / 1e-32 AT3G17880 379 / 4e-131 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.016G138800 [exp] 108 / 1e-31 AT3G08710 208 / 1e-70 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.006G110100 [exp] 108 / 2e-31 AT3G08710 178 / 1e-58 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.015G036000 [exp] 112 / 1e-30 AT3G17880 396 / 3e-137 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.017G076700 [exp] 104 / 7e-30 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Potri.008G194100 [exp] 98 / 3e-27 AT1G59730 119 / 3e-35 thioredoxin H-type 7 (.1) Potri.019G062000 [exp] 93 / 4e-25 AT3G08710 164 / 6e-53 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00085 [flax] [poplar] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Lus10028349 pacid=23166083 polypeptide=Lus10028349 locus=Lus10028349.g ID=Lus10028349.BGIv1.0 annot-version=v1.0 ATGGCAGCGGAGGAAGGATTGGTATTTGCTTGCCACACCGTTGAAGAGTGGGAAGCTCAGCTACAAAAGGCCAACGAATCTAAGAAGCTGGTGGTGGTTG ATTTCACAGCCACATGGTGCGGGCCATGCCGCTTCATTACACCATACTTGGCAGAGCTGGCTAAGAAGATGCCTATGGTAACCTTCCTGAAGGTTGATGT CGATGAAATGAAAAATGTTGCTCAAGATTGGGCTGTGGAGGCAATGCCAACATTCATGTTTATGAAAGAGGGCAAGATCGTGGGCAAAGTCGTTGGAGCC AACAAGGAAGAGCTGCTGCAGACTATTAACAAGAACTTGGACTTGGCTACCACCTCTGCTTAA
AA sequence Show only first row Show all	>Lus10028349 pacid=23166083 polypeptide=Lus10028349 locus=Lus10028349.g ID=Lus10028349.BGIv1.0 annot-version=v1.0 MAAEEGLVFACHTVEEWEAQLQKANESKKLVVVDFTATWCGPCRFITPYLAELAKKMPMVTFLKVDVDEMKNVAQDWAVEAMPTFMFMKEGKIVGKVVGA NKEELLQTINKNLDLATTSA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G51030		ATTRX1, ATTRXH1	ARABIDOPSIS THALIANA THIOREDOX...		Lus10028349 [exp]	0	1
AT3G12490		ATCYS6, ATCYSB	ARABIDOPSIS THALIANA PHYTOCYST...		Lus10026779 [exp]	2.0	0.9400
AT3G19910			RING/U-box superfamily protein...		Lus10029693 [exp]	2.4	0.9499
					Lus10025141 [exp]	3.9	0.9404
AT1G78380		GST8, ATGSTU19	GLUTATHIONE TRANSFERASE 8, A. ...		Lus10042468 [exp]	4.2	0.9179
AT1G69880		ATH8	thioredoxin H-type 8 (.1)		Lus10037225 [exp]	5.3	0.9413
AT2G41110		ACAM-2, ATCAL5,...	calmodulin 2 (.1.2)		Lus10021487 [exp]	6.3	0.9382
AT3G23230	AP2_ERF	ERF98	Integrase-type DNA-binding sup...		Lus10033884 [exp]	7.3	0.8858
AT3G51030		ATTRX1, ATTRXH1	ARABIDOPSIS THALIANA THIOREDOX...		Lus10000802 [exp]	7.9	0.9166
					Lus10003556 [exp]	8.5	0.9336
AT5G22580			Stress responsive A/B Barrel D...		Lus10020555 [exp]	10.4	0.9255

Compare expression of checked genes

Lus10028349 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.