Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G77370 171 / 3e-56 Glutaredoxin family protein (.1) AT5G20500 132 / 1e-40 Glutaredoxin family protein (.1) AT5G40370 90 / 3e-24 GRXC2 glutaredoxin C2, Glutaredoxin family protein (.1.2) AT2G20270 88 / 1e-22 Thioredoxin superfamily protein (.1.2) AT4G28730 82 / 1e-20 GrxC5 glutaredoxin C5, Glutaredoxin family protein (.1) AT5G63030 76 / 8e-19 GRXC1 glutaredoxin C1, Thioredoxin superfamily protein (.1) AT4G15660 57 / 2e-11 Thioredoxin superfamily protein (.1) AT3G21460 56 / 3e-11 Glutaredoxin family protein (.1) AT4G15700 56 / 5e-11 Thioredoxin superfamily protein (.1) AT5G14070 55 / 2e-10 ROXY2 Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021590 [exp] 137 / 2e-42 AT5G20500 180 / 1e-59 Glutaredoxin family protein (.1) Lus10017148 [exp] 130 / 5e-40 AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1) Lus10022253 [exp] 92 / 3e-25 AT5G40370 162 / 2e-53 glutaredoxin C2, Glutaredoxin family protein (.1.2) Lus10013089 [exp] 91 / 9e-25 AT5G40370 162 / 2e-53 glutaredoxin C2, Glutaredoxin family protein (.1.2) Lus10001237 [exp] 82 / 4e-21 AT5G63030 171 / 2e-56 glutaredoxin C1, Thioredoxin superfamily protein (.1) Lus10042104 [exp] 82 / 5e-21 AT5G63030 177 / 1e-58 glutaredoxin C1, Thioredoxin superfamily protein (.1) Lus10022844 [exp] 82 / 3e-20 AT4G28730 177 / 3e-57 glutaredoxin C5, Glutaredoxin family protein (.1) Lus10011915 [exp] 62 / 9e-13 AT4G28730 154 / 4e-48 glutaredoxin C5, Glutaredoxin family protein (.1) Lus10012815 [exp] 59 / 2e-12 AT3G21460 171 / 3e-57 Glutaredoxin family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G017300 [exp] 174 / 3e-57 AT1G77370 163 / 8e-53 Glutaredoxin family protein (.1) Potri.018G133400 [exp] 131 / 2e-40 AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1) Potri.002G254100 [exp] 87 / 2e-22 AT4G28730 176 / 2e-56 glutaredoxin C5, Glutaredoxin family protein (.1) Potri.001G347700 [exp] 84 / 3e-22 AT5G40370 158 / 1e-51 glutaredoxin C2, Glutaredoxin family protein (.1.2) Potri.015G078900 [exp] 74 / 7e-18 AT5G63030 171 / 3e-56 glutaredoxin C1, Thioredoxin superfamily protein (.1) Potri.012G082800 [exp] 69 / 9e-16 AT5G63030 155 / 6e-50 glutaredoxin C1, Thioredoxin superfamily protein (.1) Potri.002G208500 [exp] 62 / 1e-13 AT3G62950 171 / 5e-57 Thioredoxin superfamily protein (.1) Potri.014G134200 [exp] 62 / 1e-13 AT3G62950 169 / 4e-56 Thioredoxin superfamily protein (.1) Potri.008G214500 [exp] 57 / 1e-11 AT3G21460 177 / 2e-59 Glutaredoxin family protein (.1) Potri.001G060600 [exp] 55 / 1e-10 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00462 [flax] [poplar] Glutaredoxin Glutaredoxin
Representative CDS sequence Show only first row Show all	>Lus10028355 pacid=23166134 polypeptide=Lus10028355 locus=Lus10028355.g ID=Lus10028355.BGIv1.0 annot-version=v1.0 ATGGTTCGGGGTCGTCGATTCATTTGCGCGGTGTTTCTCAGCTCATTGCTTCTTCTCTTCACCAATGATGCAAAAGCGTCCAATTCAGCCTCCGCTTTTG TGCAGAATGTTATCTACTCCAACAGGATCGTCATCTTCTCCAAATCCTATTGCCCATATTCTATGAGGGCCAAGAAAGTCTTCAGTGAGTTGAATGAGAA GCCTTTCGTTGCAGAACTTGATCTTCGAGATGATGGTTCCCAAATTCAGTATGTTCTGCTGGAACTGGTAGGCCGTAGGACTGTCCCACAAGTGTTTGTG AACGGGAAGCACATTGGCGGCTCTGATGATTTGAGCGCGGCTGTCAGTAGTGGTGAACTAAAGAAGCTTCTGGCTAAAGACTGA
AA sequence Show only first row Show all	>Lus10028355 pacid=23166134 polypeptide=Lus10028355 locus=Lus10028355.g ID=Lus10028355.BGIv1.0 annot-version=v1.0 MVRGRRFICAVFLSSLLLLFTNDAKASNSASAFVQNVIYSNRIVIFSKSYCPYSMRAKKVFSELNEKPFVAELDLRDDGSQIQYVLLELVGRRTVPQVFV NGKHIGGSDDLSAAVSSGELKKLLAKD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G77370			Glutaredoxin family protein (....		Lus10028355 [exp]	0	1
AT5G03460			unknown protein		Lus10014419 [exp]	2.8	0.8990
AT1G50420	GRAS	SCL-3, SCL3	scarecrow-like 3 (.1)		Lus10039562 [exp]	5.3	0.8720
AT5G63910		FCLY	farnesylcysteine lyase (.1)		Lus10010948 [exp]	5.5	0.8750
					Lus10013206 [exp]	6.5	0.8511
AT5G10780			unknown protein		Lus10040473 [exp]	6.7	0.8681
AT2G20740			Tetraspanin family protein (.1...		Lus10018584 [exp]	7.1	0.8832
AT1G11910		ATAPA1, APA1	aspartic proteinase A1 (.1)		Lus10032636 [exp]	7.5	0.8762
AT3G58800			unknown protein		Lus10007354 [exp]	9.2	0.8640
AT2G28370			Uncharacterised protein family...		Lus10037399 [exp]	9.5	0.8612
AT4G31750		WIN2	HOPW1-1-interacting 2 (.1)		Lus10026239 [exp]	9.5	0.8730

Compare expression of checked genes

Lus10028355 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.