Lus10028383 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G35730 316 / 2e-103 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT1G34220 230 / 7e-69 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G25420 208 / 1e-63 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
AT2G19710 201 / 2e-56 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT4G29440 198 / 2e-55 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G13340 135 / 4e-35 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT1G79910 125 / 7e-32 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT2G14830 120 / 1e-29 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G52315 114 / 3e-28 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT4G32350 109 / 2e-25 Regulator of Vps4 activity in the MVB pathway protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041836 560 / 0 AT4G35730 423 / 2e-145 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10028724 236 / 3e-72 AT1G34220 417 / 1e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10006061 235 / 6e-72 AT1G34220 417 / 2e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10000978 218 / 6e-62 AT2G19710 308 / 6e-89 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10040542 213 / 2e-60 AT2G19710 309 / 2e-89 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10041442 182 / 3e-54 AT1G25420 270 / 6e-90 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
Lus10041468 165 / 8e-46 AT1G13340 239 / 1e-74 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10034303 155 / 2e-42 AT1G13340 243 / 5e-76 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10034330 136 / 2e-36 AT1G25420 218 / 3e-69 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G059800 389 / 1e-131 AT4G35730 385 / 7e-130 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.013G117100 238 / 6e-72 AT1G34220 357 / 2e-115 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.019G087400 235 / 3e-71 AT1G34220 357 / 5e-116 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.008G121300 223 / 1e-69 AT1G25420 361 / 3e-125 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
Potri.006G149800 223 / 1e-63 AT2G19710 300 / 3e-86 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.010G127000 152 / 4e-41 AT1G13340 268 / 1e-85 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.017G113900 140 / 2e-38 AT1G13340 211 / 9e-66 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.013G135700 135 / 5e-34 AT2G14830 228 / 2e-67 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.004G100900 134 / 1e-33 AT1G13340 223 / 1e-66 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.004G038600 124 / 2e-30 AT2G14830 175 / 3e-48 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03398 Ist1 Regulator of Vps4 activity in the MVB pathway
Representative CDS sequence
>Lus10028383 pacid=23166049 polypeptide=Lus10028383 locus=Lus10028383.g ID=Lus10028383.BGIv1.0 annot-version=v1.0
ATGACCGTCGCTAGTGTCGCCGTTTCCTCCTCCAAGAAGTTGGTGAAGTTCACTCTTTCAATCTTCCGTCCCCGTTTCAATTCTTCCAAATGTAAAACGG
CGGCCAAGATGACGGTGTCGAGGATAAAACTGTTGAAGAACAAGAGACAGGCGACTGTGAGGCAGATGAGAAGAGACATTGCTTTGCTTCTTCAGTCCGG
CCAGGATGCCACTGCTCGTATCCGGGTTGAGCATGTTATAAGAGAACAGAACGTTTTGGCTGCAAATGAGTTCATCGAGCTCTTCTGTGAGCTAGTAGTG
TCCAGACTTCAAATCATCGCAAAGCAAAGGGATTGTCCAGCGGACTTGAAAGAAGGGATTGCGAGCTTGATGTTTGCAGCCCCAAGGTGCTCCGAGATCC
CTGAACTACTCGCACTGAAGGATATTTTCGAGAAGAAGTACGGAGCTGATTTTGTGGGTGCTGCAGTTGATTTGCGACCTAGCTGTGGTGTTAATCGTAT
GTTGATTGACAAGCTCTCCGTTAGAACACCTAGTGGTGAAGTGAAGTTGAAAGTTTTGAAAGAAATTGCGAAAGAGCACCAGGTTGAATGGGATACAACC
GAGTCCGAGGAGGAGCTCCTTAAGCCTCCGGAAGAGCTTATAGATGGACCTTCCTCATTCGCCGCTGCTTCCACCTTTCCTGCTAAGCTACCTCCTAATA
ACTCTTTTCAGGCAGATAAACCAACCGTCAGATCAACTAATGAAGTTCAACCTGGTAGCACTTATTTTGGAGATGCTGCAACTGCTGCTGATGCAGCTGC
AAAATGTGCAAAGCAAGCAATTGAAGCTGCACAAGCTGCAGCTTACTTGGCTAATAGGGGCTCGAACCAGACCTCGGCGTCCAATCGTGATGTCAGATTT
GAACAAACACATCCTGACAATTCTTCTCGGTTCGGCATGCCAATGAACCTTCAGATGGATTCAAATCAGAGCTTTAATGGGTCTCCTTTTCCAAGCAGTG
AAGGGACCAGACCTATACAGGGGCATTCCGGCCGTGTCAATAGGAGGCACAGCTACAATGAGGCACCACCAACAACACGGATCGAACCTTCATACAGAAG
ATACAGCTACAATGACAGGTACGATGACCATGGGACAAATGATGGTGAAGGCTCCTCTCCACGTTCTGAACTCTTGTTTGACGAATCAGAATGCGATGAA
GAGATTGAAATGGAAGAACCAAGTGGCAATGCTCGTATACCGCCTCCTATGCGACCTCCACCGCCAGTTCCTACAGAGCATCATCCCAAGTTGCCAGACT
ACGATGAGATTGCTGCACGCTTCGAAGCTCTGAAATGCCGCAAACCAAAGGCTTAG
AA sequence
>Lus10028383 pacid=23166049 polypeptide=Lus10028383 locus=Lus10028383.g ID=Lus10028383.BGIv1.0 annot-version=v1.0
MTVASVAVSSSKKLVKFTLSIFRPRFNSSKCKTAAKMTVSRIKLLKNKRQATVRQMRRDIALLLQSGQDATARIRVEHVIREQNVLAANEFIELFCELVV
SRLQIIAKQRDCPADLKEGIASLMFAAPRCSEIPELLALKDIFEKKYGADFVGAAVDLRPSCGVNRMLIDKLSVRTPSGEVKLKVLKEIAKEHQVEWDTT
ESEEELLKPPEELIDGPSSFAAASTFPAKLPPNNSFQADKPTVRSTNEVQPGSTYFGDAATAADAAAKCAKQAIEAAQAAAYLANRGSNQTSASNRDVRF
EQTHPDNSSRFGMPMNLQMDSNQSFNGSPFPSSEGTRPIQGHSGRVNRRHSYNEAPPTTRIEPSYRRYSYNDRYDDHGTNDGEGSSPRSELLFDESECDE
EIEMEEPSGNARIPPPMRPPPPVPTEHHPKLPDYDEIAARFEALKCRKPKA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G35730 Regulator of Vps4 activity in ... Lus10028383 0 1
AT4G35730 Regulator of Vps4 activity in ... Lus10041836 1.4 0.9769
AT3G15550 unknown protein Lus10035906 4.0 0.9674
AT4G13370 Plant protein of unknown funct... Lus10043255 4.2 0.9661
AT4G13370 Plant protein of unknown funct... Lus10019398 7.5 0.9638
AT5G26910 unknown protein Lus10037725 8.8 0.9592
AT3G44530 HIRA homolog of histone chaperone H... Lus10004893 9.4 0.9224
AT1G02730 SOS6, ATCSLD5 SALT OVERLY SENSITIVE 6, CELLU... Lus10010024 10.2 0.9591
AT5G27550 P-loop containing nucleoside t... Lus10004487 11.0 0.9604
AT3G21620 ERD (early-responsive to dehyd... Lus10030024 11.0 0.9619
AT1G02730 SOS6, ATCSLD5 SALT OVERLY SENSITIVE 6, CELLU... Lus10025046 14.5 0.9497

Lus10028383 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.