Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35770 179 / 3e-58 ATSEN1, DIN1, SEN1 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) AT5G66040 168 / 1e-54 STR16 sulfurtransferase protein 16 (.1.2) AT5G66170 112 / 2e-32 STR18 sulfurtransferase 18 (.1.2.3) AT2G21045 102 / 7e-28 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT2G17850 89 / 6e-23 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT4G27700 62 / 4e-12 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT4G24750 41 / 0.0001 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT2G42220 40 / 0.0002 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041843 [exp] 254 / 2e-87 AT4G35770 182 / 6e-59 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) Lus10005635 [exp] 160 / 2e-50 AT5G66040 144 / 1e-44 sulfurtransferase protein 16 (.1.2) Lus10041525 [exp] 148 / 3e-44 AT5G14030 216 / 8e-70 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4) Lus10012566 [exp] 142 / 7e-44 AT5G66040 129 / 1e-39 sulfurtransferase protein 16 (.1.2) Lus10041895 [exp] 94 / 2e-24 AT5G66170 116 / 3e-33 sulfurtransferase 18 (.1.2.3) Lus10041894 [exp] 92 / 6e-24 AT5G66170 120 / 1e-35 sulfurtransferase 18 (.1.2.3) Lus10028442 [exp] 92 / 1e-23 AT5G66170 119 / 2e-34 sulfurtransferase 18 (.1.2.3) Lus10021227 [exp] 85 / 2e-21 AT5G66040 73 / 4e-17 sulfurtransferase protein 16 (.1.2) Lus10028441 [exp] 70 / 6e-16 AT5G66170 89 / 9e-24 sulfurtransferase 18 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G106400 [exp] 211 / 5e-70 AT4G35770 199 / 1e-64 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) Potri.002G014900 [exp] 164 / 3e-52 AT4G35770 151 / 8e-47 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) Potri.014G131300 [exp] 116 / 8e-34 AT2G21045 204 / 2e-68 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.005G111200 [exp] 105 / 1e-29 AT2G17850 162 / 5e-52 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.015G008000 [exp] 56 / 7e-10 AT4G27700 268 / 2e-91 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.012G020700 [exp] 54 / 2e-09 AT4G27700 262 / 4e-89 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.006G059200 [exp] 45 / 3e-06 AT2G42220 318 / 4e-111 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.006G100600 [exp] 41 / 0.0001 AT3G08920 238 / 6e-80 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0031 [flax] [poplar] Phosphatase PF00581 [flax] [poplar] Rhodanese Rhodanese-like domain
Representative CDS sequence Show only first row Show all	>Lus10028390 pacid=23165960 polypeptide=Lus10028390 locus=Lus10028390.g ID=Lus10028390.BGIv1.0 annot-version=v1.0 ATGGAATCCTGCAGATCAATTGTTTCGTCCAGTACTGCTGGTTTGACCGCCGCTTCGCTTGCTCCGCTTCTTCAACTTCCTTCAAATGTGAAAGTCTCTT CCAGCGCGAAGGCGGTTGTGGGGGAGAACTTGAATGCGGCAGCGGTTCCGACATCAGTGCCAGTAAGAGTAGCGTATGAACTTCTGCTAGCTGGACATCG CTACCTTGATGTGAGGACGCCGGAAGAGTTCAGCGCAGGACACCCAGAAGGAGCAGTCAACGTCCCTTACATGTATAGAGTTGGTTCAGGTTTGGCAAAG AACCCAAAATTTGTAGAGCAAGTTTCATCACAGTTTGGCAAGTACAATGAGATCATTGTTGGTTGTCAGCTAGGGAAAAGGTCAATGATGGCGGCAACTG ATCTTTTAGCTGCCGGTTTCATGGCAGTGACAGACATAGCCGGTGGGTATGCAGCTTGGACGCAGAATGGCCTCCCGACTGAGAAGTAA
AA sequence Show only first row Show all	>Lus10028390 pacid=23165960 polypeptide=Lus10028390 locus=Lus10028390.g ID=Lus10028390.BGIv1.0 annot-version=v1.0 MESCRSIVSSSTAGLTAASLAPLLQLPSNVKVSSSAKAVVGENLNAAAVPTSVPVRVAYELLLAGHRYLDVRTPEEFSAGHPEGAVNVPYMYRVGSGLAK NPKFVEQVSSQFGKYNEIIVGCQLGKRSMMAATDLLAAGFMAVTDIAGGYAAWTQNGLPTEK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G35770		ATSEN1, DIN1, S...	SENESCENCE ASSOCIATED GENE 1, ...		Lus10028390 [exp]	0	1
AT4G35770		ATSEN1, DIN1, S...	SENESCENCE ASSOCIATED GENE 1, ...		Lus10041843 [exp]	1.0	0.9752
AT5G38900			Thioredoxin superfamily protei...		Lus10005082 [exp]	1.7	0.9535
AT3G50980		XERO1	dehydrin xero 1 (.1)		Lus10014280 [exp]	2.2	0.9402
AT4G33580		ATBCA5	A. THALIANA BETA CARBONIC ANHY...		Lus10015892 [exp]	2.8	0.9547
					Lus10028391 [exp]	4.9	0.9180
AT5G20950			Glycosyl hydrolase family prot...		Lus10013646 [exp]	6.9	0.9274
AT5G27830			unknown protein		Lus10029881 [exp]	7.2	0.9413
AT1G10070		ATBCAT-2	branched-chain amino acid tran...		Lus10028246 [exp]	11.0	0.9263
AT1G10150		ATPP2-A10	Carbohydrate-binding protein (...		Lus10003785 [exp]	11.1	0.8527
AT3G13750		BGAL1	beta-galactosidase 1, beta gal...		Lus10015625 [exp]	14.4	0.9151

Compare expression of checked genes

Lus10028390 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.