Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041844 [exp] 0 / 1 AT3G51380 100 / 9e-29 IQ-domain 20 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G106300 [exp] 0 / 1 AT3G51380 85 / 2e-22 IQ-domain 20 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028391 pacid=23166128 polypeptide=Lus10028391 locus=Lus10028391.g ID=Lus10028391.BGIv1.0 annot-version=v1.0 ATGAGGATGCCTAAGAACTGGTTTAGCAGAATCGGAAGAAAGCTCCTGAGTTGTCGATCCCACAGAAGTCGAGATGCCGCTTGCAATACCATGGACATGG AAGGCACAAAAGCTCCGCCAGATTCAAACAATCTAGACTTGGCAGCAATCAAGATCCAAGCCACTTTCAGGGCTCACCTGCTGCAAACGTGTTATCTCTG TAAAGCTCTCTCCCTCTCTCTCTCTGCAGGCAAGGCGAGCATTCCGAGCACTCAGAAGCTTGGTGAAGGTGCAGGCACTGGCTCGAGGGGTCTACGTCAG AAGACAGTCTCAGATAGCTCTGCATTGCATGCGCGCCCTTGTCCGGTTGCAGGTCAGGGTTCGTGCCAGACAGCTCTTGGCAAGATGCACTGA
AA sequence Show only first row Show all	>Lus10028391 pacid=23166128 polypeptide=Lus10028391 locus=Lus10028391.g ID=Lus10028391.BGIv1.0 annot-version=v1.0 MRMPKNWFSRIGRKLLSCRSHRSRDAACNTMDMEGTKAPPDSNNLDLAAIKIQATFRAHLLQTCYLCKALSLSLSAGKASIPSTQKLGEGAGTGSRGLRQ KTVSDSSALHARPCPVAGQGSCQTALGKMH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10028391 [exp]	0	1
AT4G35770		ATSEN1, DIN1, S...	SENESCENCE ASSOCIATED GENE 1, ...		Lus10041843 [exp]	3.5	0.9391
AT4G35770		ATSEN1, DIN1, S...	SENESCENCE ASSOCIATED GENE 1, ...		Lus10028390 [exp]	4.9	0.9180
AT3G07350			Protein of unknown function (D...		Lus10002335 [exp]	7.1	0.9090
					Lus10039819 [exp]	9.2	0.8928
AT1G10710		PHS1	poor homologous synapsis 1 (.1...		Lus10018084 [exp]	11.2	0.9046
AT5G38900			Thioredoxin superfamily protei...		Lus10005082 [exp]	14.0	0.9028
AT5G67480		ATBT4, BT4	BTB and TAZ domain protein 4 (...		Lus10011523 [exp]	17.1	0.8526
AT1G23540		IGI1, AtPERK12	proline-rich extensin-like rec...		Lus10030610 [exp]	17.3	0.8373
AT4G33580		ATBCA5	A. THALIANA BETA CARBONIC ANHY...		Lus10015892 [exp]	17.8	0.9113
AT5G67480		ATBT4, BT4	BTB and TAZ domain protein 4 (...		Lus10019299 [exp]	20.5	0.9116

Compare expression of checked genes

Lus10028391 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.