Lus10028416 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G13440 266 / 2e-91 Ubiquinol-cytochrome C reductase iron-sulfur subunit (.1)
AT5G13430 265 / 3e-91 Ubiquinol-cytochrome C reductase iron-sulfur subunit (.1)
AT4G03280 56 / 3e-10 PGR1, PETC PROTON GRADIENT REGULATION 1, photosynthetic electron transfer C (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035118 284 / 9e-99 AT5G13430 379 / 8e-134 Ubiquinol-cytochrome C reductase iron-sulfur subunit (.1)
Lus10031982 284 / 1e-98 AT5G13430 379 / 4e-134 Ubiquinol-cytochrome C reductase iron-sulfur subunit (.1)
Lus10041870 284 / 2e-98 AT5G13430 378 / 1e-133 Ubiquinol-cytochrome C reductase iron-sulfur subunit (.1)
Lus10041513 279 / 2e-96 AT5G13430 376 / 9e-133 Ubiquinol-cytochrome C reductase iron-sulfur subunit (.1)
Lus10012580 274 / 9e-95 AT5G13430 373 / 2e-131 Ubiquinol-cytochrome C reductase iron-sulfur subunit (.1)
Lus10039739 56 / 6e-10 AT4G03280 306 / 1e-106 PROTON GRADIENT REGULATION 1, photosynthetic electron transfer C (.1.2)
Lus10018521 56 / 6e-10 AT4G03280 306 / 1e-106 PROTON GRADIENT REGULATION 1, photosynthetic electron transfer C (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G067900 268 / 3e-92 AT5G13430 413 / 4e-147 Ubiquinol-cytochrome C reductase iron-sulfur subunit (.1)
Potri.003G162200 263 / 1e-90 AT5G13430 417 / 8e-149 Ubiquinol-cytochrome C reductase iron-sulfur subunit (.1)
Potri.019G118500 51 / 2e-08 AT4G03280 318 / 4e-111 PROTON GRADIENT REGULATION 1, photosynthetic electron transfer C (.1.2)
Potri.013G148900 51 / 2e-08 AT4G03280 311 / 3e-108 PROTON GRADIENT REGULATION 1, photosynthetic electron transfer C (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0516 ISP-domain PF00355 Rieske Rieske [2Fe-2S] domain
Representative CDS sequence
>Lus10028416 pacid=23166008 polypeptide=Lus10028416 locus=Lus10028416.g ID=Lus10028416.BGIv1.0 annot-version=v1.0
ATGTCTGCAAGTAAGGATGTGCTGGCATTGGCATCGCTCGAGGTCGATCTCTCCAGCATTGAACCAGGGACCACTGTAACTGTGAAGTGGCGTGGTAAGC
CGGTTTTCATCAGGCGCCGAACAGAGGATGATATCCAGTTGGCAAACAGTGTTGAGTTGGCATCTCTCCGAGACCCACAGCCAGATGGTGACCGCGTGAA
GAACCCGGAATGGCTTATCGTTATCGGGGTGTGCACACATCTGGGTTGCATTCCATTGCCGAATGCTGGTGATTTCGGCGGGTGGTTCTGCCCCTGCCAT
GGATCTCATTATGACATCTCCGGCCGGATAAGGAAGGGCCCTGCTCCATACAACTTGGAGGTGCCTACGTATTCCTTTTTGGAAGACAACAAGCTACTCA
TTGGCTGA
AA sequence
>Lus10028416 pacid=23166008 polypeptide=Lus10028416 locus=Lus10028416.g ID=Lus10028416.BGIv1.0 annot-version=v1.0
MSASKDVLALASLEVDLSSIEPGTTVTVKWRGKPVFIRRRTEDDIQLANSVELASLRDPQPDGDRVKNPEWLIVIGVCTHLGCIPLPNAGDFGGWFCPCH
GSHYDISGRIRKGPAPYNLEVPTYSFLEDNKLLIG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G13440 Ubiquinol-cytochrome C reducta... Lus10028416 0 1
AT5G44080 bZIP Basic-leucine zipper (bZIP) tr... Lus10029784 4.7 0.7892
AT2G34585 unknown protein Lus10038503 4.9 0.7666
AT5G55670 RNA-binding (RRM/RBD/RNP motif... Lus10038758 8.9 0.7405
AT5G27930 Protein phosphatase 2C family ... Lus10029874 9.2 0.7658
AT3G45210 Protein of unknown function, D... Lus10000724 13.8 0.7445
AT4G10925 Nuclear transport factor 2 (NT... Lus10023064 14.5 0.7416
AT5G53020 Ribonuclease P protein subunit... Lus10022396 15.2 0.7564
AT3G57080 RPB5B, NRPE5 RNA POLYMERASE II FIFTH LARGES... Lus10018022 15.9 0.7272
AT3G51370 Protein phosphatase 2C family ... Lus10028408 21.5 0.7445
AT5G23680 Sterile alpha motif (SAM) doma... Lus10036012 27.5 0.7119

Lus10028416 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.