Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G13430 50 / 6e-08 Ubiquinol-cytochrome C reductase iron-sulfur subunit (.1) AT5G13440 46 / 9e-07 Ubiquinol-cytochrome C reductase iron-sulfur subunit (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041870 [exp] 165 / 6e-52 AT5G13430 378 / 1e-133 Ubiquinol-cytochrome C reductase iron-sulfur subunit (.1) Lus10035118 [exp] 159 / 1e-49 AT5G13430 379 / 8e-134 Ubiquinol-cytochrome C reductase iron-sulfur subunit (.1) Lus10031982 [exp] 159 / 1e-49 AT5G13430 379 / 4e-134 Ubiquinol-cytochrome C reductase iron-sulfur subunit (.1) Lus10012580 [exp] 108 / 6e-30 AT5G13430 373 / 2e-131 Ubiquinol-cytochrome C reductase iron-sulfur subunit (.1) Lus10041513 [exp] 106 / 5e-29 AT5G13430 376 / 9e-133 Ubiquinol-cytochrome C reductase iron-sulfur subunit (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G162200 [exp] 54 / 1e-09 AT5G13430 417 / 8e-149 Ubiquinol-cytochrome C reductase iron-sulfur subunit (.1) Potri.001G067900 [exp] 52 / 7e-09 AT5G13430 413 / 4e-147 Ubiquinol-cytochrome C reductase iron-sulfur subunit (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028417 pacid=23166137 polypeptide=Lus10028417 locus=Lus10028417.g ID=Lus10028417.BGIv1.0 annot-version=v1.0 ATGTTGAGGGTTGGATTGCGGCGGCTAACCTCTCTCTCTTCCTCATTGGGGAGGCCTAACCAGGCTATCACCGCAATCGGGACTCAGAATCCCCTTCATC GAGCTTCCCCTGATTCGCGGCGTTCAGCCGATGAACTCAAGGCCGACCGCCTCGCCACCTATTACTTTTCTCACCGAGATTTTCGGTCGCTTGCCACAGT AGATGATGAAGGTGTAGCTCCTGGAACCCTAGCAACAGTTCATGCTCTTAAGAATCCGACACCTAAGATAGTATATGACGAGTACAACCATGAGCGGATG CCTCCAGGTGACCAAGCAAGAGGGCATTCGCCTATTTTGTGCTCTCAGGGGGTAGGTTTGTGTATGCTTCACTGA
AA sequence Show only first row Show all	>Lus10028417 pacid=23166137 polypeptide=Lus10028417 locus=Lus10028417.g ID=Lus10028417.BGIv1.0 annot-version=v1.0 MLRVGLRRLTSLSSSLGRPNQAITAIGTQNPLHRASPDSRRSADELKADRLATYYFSHRDFRSLATVDDEGVAPGTLATVHALKNPTPKIVYDEYNHERM PPGDQARGHSPILCSQGVGLCMLH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G13430			Ubiquinol-cytochrome C reducta...		Lus10028417 [exp]	0	1
AT4G14350			AGC (cAMP-dependent, cGMP-depe...		Lus10011814 [exp]	5.4	0.8034
AT5G55260		EP128, PPX-2, P...	PROTEIN PHOSPHATASE X -2, prot...		Lus10016576 [exp]	7.3	0.7881
AT2G42160		BRIZ1	BRAP2 RING ZnF UBP domain-cont...		Lus10038095 [exp]	12.8	0.7667
AT1G59650		CW14	Protein of unknown function (D...		Lus10039463 [exp]	13.0	0.7849
AT2G44770			ELMO/CED-12 family protein (.1...		Lus10024285 [exp]	14.7	0.7679
AT4G14230			CBS domain-containing protein ...		Lus10034024 [exp]	15.6	0.7473
AT2G47070	SBP	SPL1	squamosa promoter binding prot...		Lus10010071 [exp]	20.8	0.7643
AT1G59750	ARF	ARF1	auxin response factor 1 (.1.2....		Lus10024455 [exp]	29.7	0.7553
					Lus10029084 [exp]	36.4	0.7450
AT1G08420		BSL2	BRI1 suppressor 1 (BSU1)-like ...		Lus10013357 [exp]	38.5	0.7614

Compare expression of checked genes

Lus10028417 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.