Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G39770 108 / 3e-30 VTC1, SOZ1, GMP1, EMB101, CYT1 VITAMIN C DEFECTIVE 1, SENSITIVE TO OZONE 1, GDP-MANNOSE PYROPHOSPHORYLASE 1, EMBRYO DEFECTIVE 101, CYTOKINESIS DEFECTIVE 1, Glucose-1-phosphate adenylyltransferase family protein (.1.2) AT3G55590 86 / 8e-22 Glucose-1-phosphate adenylyltransferase family protein (.1) AT4G30570 74 / 1e-17 Glucose-1-phosphate adenylyltransferase family protein (.1) AT1G74910 52 / 1e-09 ADP-glucose pyrophosphorylase family protein (.1.2.3) AT2G04650 48 / 3e-08 ADP-glucose pyrophosphorylase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024356 [exp] 112 / 1e-31 AT2G39770 666 / 0.0 VITAMIN C DEFECTIVE 1, SENSITIVE TO OZONE 1, GDP-MANNOSE PYROPHOSPHORYLASE 1, EMBRYO DEFECTIVE 101, CYTOKINESIS DEFECTIVE 1, Glucose-1-phosphate adenylyltransferase family protein (.1.2) Lus10004699 [exp] 105 / 3e-29 AT2G39770 678 / 0.0 VITAMIN C DEFECTIVE 1, SENSITIVE TO OZONE 1, GDP-MANNOSE PYROPHOSPHORYLASE 1, EMBRYO DEFECTIVE 101, CYTOKINESIS DEFECTIVE 1, Glucose-1-phosphate adenylyltransferase family protein (.1.2) Lus10040265 [exp] 105 / 3e-29 AT2G39770 678 / 0.0 VITAMIN C DEFECTIVE 1, SENSITIVE TO OZONE 1, GDP-MANNOSE PYROPHOSPHORYLASE 1, EMBRYO DEFECTIVE 101, CYTOKINESIS DEFECTIVE 1, Glucose-1-phosphate adenylyltransferase family protein (.1.2) Lus10001014 [exp] 102 / 5e-28 AT2G39770 476 / 1e-169 VITAMIN C DEFECTIVE 1, SENSITIVE TO OZONE 1, GDP-MANNOSE PYROPHOSPHORYLASE 1, EMBRYO DEFECTIVE 101, CYTOKINESIS DEFECTIVE 1, Glucose-1-phosphate adenylyltransferase family protein (.1.2) Lus10010880 [exp] 90 / 5e-24 AT2G39770 115 / 4e-30 VITAMIN C DEFECTIVE 1, SENSITIVE TO OZONE 1, GDP-MANNOSE PYROPHOSPHORYLASE 1, EMBRYO DEFECTIVE 101, CYTOKINESIS DEFECTIVE 1, Glucose-1-phosphate adenylyltransferase family protein (.1.2) Lus10032440 [exp] 40 / 1e-05 AT1G74910 747 / 0.0 ADP-glucose pyrophosphorylase family protein (.1.2.3) Lus10042942 [exp] 39 / 5e-05 AT1G74910 734 / 0.0 ADP-glucose pyrophosphorylase family protein (.1.2.3) Lus10030156 [exp] 0 / 1 AT2G39770 518 / 0.0 VITAMIN C DEFECTIVE 1, SENSITIVE TO OZONE 1, GDP-MANNOSE PYROPHOSPHORYLASE 1, EMBRYO DEFECTIVE 101, CYTOKINESIS DEFECTIVE 1, Glucose-1-phosphate adenylyltransferase family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G090300 [exp] 109 / 6e-31 AT2G39770 669 / 0.0 VITAMIN C DEFECTIVE 1, SENSITIVE TO OZONE 1, GDP-MANNOSE PYROPHOSPHORYLASE 1, EMBRYO DEFECTIVE 101, CYTOKINESIS DEFECTIVE 1, Glucose-1-phosphate adenylyltransferase family protein (.1.2) Potri.010G198800 [exp] 105 / 5e-29 AT2G39770 685 / 0.0 VITAMIN C DEFECTIVE 1, SENSITIVE TO OZONE 1, GDP-MANNOSE PYROPHOSPHORYLASE 1, EMBRYO DEFECTIVE 101, CYTOKINESIS DEFECTIVE 1, Glucose-1-phosphate adenylyltransferase family protein (.1.2) Potri.008G060100 [exp] 102 / 4e-28 AT2G39770 648 / 0.0 VITAMIN C DEFECTIVE 1, SENSITIVE TO OZONE 1, GDP-MANNOSE PYROPHOSPHORYLASE 1, EMBRYO DEFECTIVE 101, CYTOKINESIS DEFECTIVE 1, Glucose-1-phosphate adenylyltransferase family protein (.1.2) Potri.012G075500 [exp] 54 / 3e-10 AT1G74910 717 / 0.0 ADP-glucose pyrophosphorylase family protein (.1.2.3) Potri.008G006700 [exp] 48 / 2e-08 AT2G39770 619 / 0.0 VITAMIN C DEFECTIVE 1, SENSITIVE TO OZONE 1, GDP-MANNOSE PYROPHOSPHORYLASE 1, EMBRYO DEFECTIVE 101, CYTOKINESIS DEFECTIVE 1, Glucose-1-phosphate adenylyltransferase family protein (.1.2) Potri.015G070500 [exp] 40 / 2e-05 AT1G74910 736 / 0.0 ADP-glucose pyrophosphorylase family protein (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028418 pacid=23166138 polypeptide=Lus10028418 locus=Lus10028418.g ID=Lus10028418.BGIv1.0 annot-version=v1.0 ATGCGAGGCGTTCGAATCAAGAAGCATGCTTGCATTTCGAGTAGCATCGTAGGCTGGCATTCTACGGTAGGGAGGTGGGCACGTATTGAGAACATGACGA TTCTCGGCGAGGATGTTCATGTTGGTGATGACGTTTATAGCAACGCCAGTGTTGTCCTGCCTTACAAGGATAAGACATAG
AA sequence Show only first row Show all	>Lus10028418 pacid=23166138 polypeptide=Lus10028418 locus=Lus10028418.g ID=Lus10028418.BGIv1.0 annot-version=v1.0 MRGVRIKKHACISSSIVGWHSTVGRWARIENMTILGEDVHVGDDVYSNASVVLPYKDKT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G39770		VTC1, SOZ1, GMP...	VITAMIN C DEFECTIVE 1, SENSITI...		Lus10028418 [exp]	0	1
AT5G07480		KUOX1	KAR-UP oxidoreductase 1 (.1)		Lus10043000 [exp]	3.6	0.9648
AT2G26390			Serine protease inhibitor (SER...		Lus10039336 [exp]	5.1	0.9606
AT4G10850		SWEET7, AtSWEET...	Nodulin MtN3 family protein (....		Lus10023047 [exp]	6.5	0.9604
AT5G12060			Plant self-incompatibility pro...		Lus10023195 [exp]	7.5	0.9604
AT5G17600			RING/U-box superfamily protein...		Lus10008458 [exp]	8.4	0.9604
AT4G35610	C2H2ZnF		zinc finger (C2H2 type) family...		Lus10035994 [exp]	9.2	0.9584
AT3G08710		TRXH9, ATH9	THIOREDOXIN TYPE H 9, thioredo...		Lus10030505 [exp]	9.9	0.9574
AT3G62770		ATATG18A	autophagy 18a, Transducin/WD40...		Lus10023022 [exp]	10.6	0.9559
AT1G76810			eukaryotic translation initiat...		Lus10023474 [exp]	11.2	0.9555
AT5G54010			UDP-Glycosyltransferase superf...		Lus10008453 [exp]	11.8	0.9554

Compare expression of checked genes

Lus10028418 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.