Lus10028419 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G35900 57 / 1e-11 bZIP ATBZIP14, FD-1, FD Basic-leucine zipper (bZIP) transcription factor family protein (.1)
AT2G17770 51 / 9e-10 bZIP FDP, ATBZIP27 FD PARALOG, basic region/leucine zipper motif 27 (.1.2)
AT3G56850 35 / 0.0007 bZIP DPBF3, AREB3 ABA-responsive element binding protein 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006489 39 / 6e-05 AT1G45249 297 / 1e-97 ABSCISIC ACID RESPONSIVE ELEMENTS-BINDING PROTEIN 2, abscisic acid responsive elements-binding factor 2 (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G109500 54 / 1e-10 AT4G35900 179 / 5e-55 Basic-leucine zipper (bZIP) transcription factor family protein (.1)
Potri.002G018400 49 / 1e-08 AT4G35900 133 / 5e-38 Basic-leucine zipper (bZIP) transcription factor family protein (.1)
Potri.005G243400 44 / 7e-07 AT4G35900 117 / 4e-31 Basic-leucine zipper (bZIP) transcription factor family protein (.1)
Potri.016G024000 37 / 0.0002 AT3G56850 241 / 4e-79 ABA-responsive element binding protein 3 (.1)
Potri.006G025800 36 / 0.0005 AT3G56850 271 / 7e-91 ABA-responsive element binding protein 3 (.1)
Potri.002G125400 35 / 0.0009 AT1G45249 306 / 4e-100 ABSCISIC ACID RESPONSIVE ELEMENTS-BINDING PROTEIN 2, abscisic acid responsive elements-binding factor 2 (.1.2.3)
PFAM info
Representative CDS sequence
>Lus10028419 pacid=23165971 polypeptide=Lus10028419 locus=Lus10028419.g ID=Lus10028419.BGIv1.0 annot-version=v1.0
ATGTTCCTCCTTTTTTCACTTCAGGCGTACACCAATGAATTGGAGCTGGAAGTTCAGCATCTCATGACAGAAAATGCGAAGCTGAAGAAGCAACAAGAAG
AGTTGCGGTTGGCTGCAGCAGCGGCTCAGGTTGGCAAAAAGACCACTCTATTCCGGACGTCAACATTCTGA
AA sequence
>Lus10028419 pacid=23165971 polypeptide=Lus10028419 locus=Lus10028419.g ID=Lus10028419.BGIv1.0 annot-version=v1.0
MFLLFSLQAYTNELELEVQHLMTENAKLKKQQEELRLAAAAAQVGKKTTLFRTSTF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G35900 bZIP ATBZIP14, FD-1,... Basic-leucine zipper (bZIP) tr... Lus10028419 0 1
AT2G31160 OBO1, LSH3 ORGAN BOUNDARY 1, LIGHT SENSIT... Lus10024901 4.6 0.8739
AT1G03840 C2H2ZnF MGP Magpie, C2H2 and C2HC zinc fin... Lus10042626 12.1 0.9086
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10014359 19.1 0.8996
AT1G23220 Dynein light chain type 1 fami... Lus10021793 21.6 0.8775
AT2G27990 HD PNF, BLH8 POUND-FOOLISH, BEL1-like homeo... Lus10040256 24.2 0.8875
Lus10014949 27.7 0.8775
AT2G14660 unknown protein Lus10033766 28.8 0.8452
Lus10007416 33.4 0.8740
AT5G04347 Plant self-incompatibility pro... Lus10022824 35.8 0.7547
AT3G10490 NAC ANAC051, ANAC05... Arabidopsis NAC domain contain... Lus10037939 36.5 0.8121

Lus10028419 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.