Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35905 114 / 2e-35 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041873 [exp] 169 / 7e-57 AT4G35905 114 / 3e-35 unknown protein
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF03966 [flax] [poplar] Trm112p Trm112p-like protein
Representative CDS sequence Show only first row Show all	>Lus10028420 pacid=23165984 polypeptide=Lus10028420 locus=Lus10028420.g ID=Lus10028420.BGIv1.0 annot-version=v1.0 ATGGTGAGGTTGGGGAAGGCGATGCTGAAAGAAGCTGCTAATGGAATCGGCAAAACACTTTCCGAAGCTCTAGTCTGCCCACTCTCCAAGCAACCCTTAA GGTACTGCAAGGAAACCAATTCCCTAATCAGCGATTCCATTGGCGTCTCTTTTCCTATAAAGGATGGGATCCCTTGCTTGGTACCTCGAGATGGCAAGAT ACTTGAAGCTGCCGATGATAACCATGGGGATCCAGCTACAACTCATTGA
AA sequence Show only first row Show all	>Lus10028420 pacid=23165984 polypeptide=Lus10028420 locus=Lus10028420.g ID=Lus10028420.BGIv1.0 annot-version=v1.0 MVRLGKAMLKEAANGIGKTLSEALVCPLSKQPLRYCKETNSLISDSIGVSFPIKDGIPCLVPRDGKILEAADDNHGDPATTH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G35905			unknown protein		Lus10028420 [exp]	0	1
AT1G15860			Domain of unknown function (DU...		Lus10026216 [exp]	5.5	0.8926
AT3G28050			nodulin MtN21 /EamA-like trans...		Lus10039428 [exp]	8.9	0.8755
AT1G50670			OTU-like cysteine protease fam...		Lus10040075 [exp]	8.9	0.8517
AT4G20330			Transcription initiation facto...		Lus10029563 [exp]	9.9	0.8700
AT5G55810		ATNMNAT	nicotinate/nicotinamide mononu...		Lus10023862 [exp]	11.4	0.8797
AT5G04980			DNAse I-like superfamily prote...		Lus10008934 [exp]	12.2	0.8296
AT4G22310			Uncharacterised protein family...		Lus10011790 [exp]	14.1	0.8778
AT4G10920		KELP	transcriptional coactivator p1...		Lus10023061 [exp]	18.8	0.8731
AT1G04555			unknown protein		Lus10023715 [exp]	19.3	0.8705
AT5G59140			BTB/POZ domain-containing prot...		Lus10016485 [exp]	19.9	0.8507

Compare expression of checked genes

Lus10028420 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.