Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35980 139 / 9e-45 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041889 [exp] 177 / 5e-60 AT4G35980 141 / 1e-45 unknown protein Lus10009388 [exp] 81 / 4e-22 AT4G35980 66 / 3e-16 unknown protein Lus10042598 [exp] 83 / 4e-21 AT4G35980 71 / 3e-16 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G111900 [exp] 149 / 8e-49 AT4G35980 139 / 5e-45 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028436 pacid=23166001 polypeptide=Lus10028436 locus=Lus10028436.g ID=Lus10028436.BGIv1.0 annot-version=v1.0 ATGAAAGAATACGAGATTGAAGAGAAAAAGCAAGCTGCAGCTGATGTATTGTTCCACTACTCCAAGTTTGTGATGACGTGTATTGGGAACCAAGTTCGCC CCTGCGACATGAGGCTGCATCTGATGAAGGAGATATCAGGAATCCCAACATCTCTGAAGAAAGAACCTTCTCAGATGGCTGCCTTGCCCGATGTGATGGG TGAATCATCGAGCTCAGGTACTGCTAGACTTGATAAAACAGACAGTTTCCGTGCACTTTAG
AA sequence Show only first row Show all	>Lus10028436 pacid=23166001 polypeptide=Lus10028436 locus=Lus10028436.g ID=Lus10028436.BGIv1.0 annot-version=v1.0 MKEYEIEEKKQAAADVLFHYSKFVMTCIGNQVRPCDMRLHLMKEISGIPTSLKKEPSQMAALPDVMGESSSSGTARLDKTDSFRAL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G35980			unknown protein		Lus10028436 [exp]	0	1
AT1G15340		MBD10	methyl-CPG-binding domain 10 (...		Lus10019406 [exp]	1.4	0.9366
AT5G59460			scarecrow-like transcription f...		Lus10004969 [exp]	3.0	0.9135
AT3G05760	C2H2ZnF		C2H2 and C2HC zinc fingers sup...		Lus10010928 [exp]	3.5	0.9023
AT4G35905			unknown protein		Lus10041873 [exp]	5.0	0.9038
AT3G60330		AHA7	H\(+\)-ATPase 7, H\(+\)-ATPase...		Lus10042905 [exp]	5.3	0.9208
AT5G59140			BTB/POZ domain-containing prot...		Lus10016485 [exp]	7.3	0.8810
AT5G58005			Cytochrome c oxidase, subunit ...		Lus10021847 [exp]	8.7	0.8649
AT3G18760			Translation elongation factor...		Lus10038301 [exp]	9.2	0.8858
AT3G05580		TOPP9	type one protein phosphatase 9...		Lus10031489 [exp]	10.6	0.9021
AT4G31720		STG1, TAFII15, ...	TBP-ASSOCIATED FACTOR 10, SALT...		Lus10034375 [exp]	11.0	0.9085

Compare expression of checked genes

Lus10028436 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.