Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G66170 89 / 1e-23 STR18 sulfurtransferase 18 (.1.2.3) AT5G66040 81 / 1e-20 STR16 sulfurtransferase protein 16 (.1.2) AT2G21045 82 / 2e-20 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT2G17850 78 / 4e-19 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT4G35770 73 / 6e-17 ATSEN1, DIN1, SEN1 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) AT4G27700 43 / 1e-05 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041894 [exp] 229 / 5e-79 AT5G66170 120 / 1e-35 sulfurtransferase 18 (.1.2.3) Lus10041895 [exp] 124 / 7e-37 AT5G66170 116 / 3e-33 sulfurtransferase 18 (.1.2.3) Lus10028442 [exp] 122 / 3e-36 AT5G66170 119 / 2e-34 sulfurtransferase 18 (.1.2.3) Lus10028390 [exp] 71 / 2e-16 AT4G35770 182 / 3e-59 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) Lus10005635 [exp] 69 / 3e-15 AT5G66040 144 / 1e-44 sulfurtransferase protein 16 (.1.2) Lus10041843 [exp] 68 / 6e-15 AT4G35770 182 / 6e-59 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) Lus10041525 [exp] 68 / 2e-14 AT5G14030 216 / 8e-70 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4) Lus10012566 [exp] 62 / 5e-13 AT5G66040 129 / 1e-39 sulfurtransferase protein 16 (.1.2) Lus10023243 [exp] 45 / 3e-06 AT4G27700 305 / 7e-106 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G111200 [exp] 102 / 6e-29 AT2G17850 162 / 5e-52 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.014G131300 [exp] 83 / 2e-21 AT2G21045 204 / 2e-68 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.005G106400 [exp] 74 / 6e-17 AT4G35770 199 / 1e-64 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) Potri.002G014900 [exp] 72 / 1e-16 AT4G35770 151 / 8e-47 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) Potri.006G100600 [exp] 42 / 3e-05 AT3G08920 238 / 6e-80 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.012G020700 [exp] 38 / 0.0005 AT4G27700 262 / 4e-89 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.015G008000 [exp] 38 / 0.0007 AT4G27700 268 / 2e-91 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0031 [flax] [poplar] Phosphatase PF00581 [flax] [poplar] Rhodanese Rhodanese-like domain
Representative CDS sequence Show only first row Show all	>Lus10028441 pacid=23166017 polypeptide=Lus10028441 locus=Lus10028441.g ID=Lus10028441.BGIv1.0 annot-version=v1.0 ATGGAGGAGGATTTCAGGGCAGCACATGCTGATGCAGACACGGTCTGGAAACAAAGAGCGCAGCTGGTTGCTGAGACTGCTGCTGATGATGTCCCGAAGA TCTACAATGTTCCTTACTATGTCCACGCTCCTGAAGGCAGAGTGAAGAATCCCGAGTTCTTGGAGGAGGTCAGGAAGATTTTCAAGGATGACGACCATCT CGTCGTGGGGTGCGGCACTGGTGGGAGATCTAGTTTGGCAACTGCTGATCTTCTGACTGCAGGGGTTCAGGGTATGAAGAATGTTAACAACTTGGGTGGA GGGTACCGGGCTTGGGAGAAGAATGGGTTCCCTGTGATTAAACAGCTAAAGGAACAACAACCCATCTGA
AA sequence Show only first row Show all	>Lus10028441 pacid=23166017 polypeptide=Lus10028441 locus=Lus10028441.g ID=Lus10028441.BGIv1.0 annot-version=v1.0 MEEDFRAAHADADTVWKQRAQLVAETAADDVPKIYNVPYYVHAPEGRVKNPEFLEEVRKIFKDDDHLVVGCGTGGRSSLATADLLTAGVQGMKNVNNLGG GYRAWEKNGFPVIKQLKEQQPI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G66170		STR18	sulfurtransferase 18 (.1.2.3)		Lus10028441 [exp]	0	1
AT1G06400		ARA2, AtRABA1a,...	ARABIDOPSIS THALIANA RAB GTPAS...		Lus10020746 [exp]	13.0	0.8072
AT5G57330			Galactose mutarotase-like supe...		Lus10000414 [exp]	21.5	0.8170
AT1G63855			Putative methyltransferase fam...		Lus10041869 [exp]	53.4	0.8108
					Lus10010825 [exp]	54.4	0.7818
AT4G20260		ATPCAP1	ARABIDOPSIS THALIANA PLASMA-ME...		Lus10038383 [exp]	64.8	0.8107
AT1G29640			Protein of unknown function, D...		Lus10011993 [exp]	70.2	0.7484
AT1G64230		UBC28	ubiquitin-conjugating enzyme 2...		Lus10014942 [exp]	91.8	0.7963
					Lus10041110 [exp]	118.1	0.7865
AT5G51780	bHLH	bHLH036	basic helix-loop-helix (bHLH) ...		Lus10031676 [exp]	118.8	0.7857
AT4G00170			Plant VAMP (vesicle-associated...		Lus10010360 [exp]	143.0	0.7793

Compare expression of checked genes

Lus10028441 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.