Lus10028442 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G66170 119 / 1e-34 STR18 sulfurtransferase 18 (.1.2.3)
AT2G17850 102 / 8e-28 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT2G21045 97 / 2e-25 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT5G66040 87 / 5e-22 STR16 sulfurtransferase protein 16 (.1.2)
AT4G35770 87 / 2e-21 ATSEN1, DIN1, SEN1 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
AT4G27700 44 / 2e-05 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT4G24750 40 / 0.0008 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041895 357 / 2e-127 AT5G66170 116 / 3e-33 sulfurtransferase 18 (.1.2.3)
Lus10041894 166 / 2e-52 AT5G66170 120 / 1e-35 sulfurtransferase 18 (.1.2.3)
Lus10028441 122 / 4e-36 AT5G66170 89 / 9e-24 sulfurtransferase 18 (.1.2.3)
Lus10028390 93 / 7e-24 AT4G35770 182 / 3e-59 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
Lus10041843 90 / 2e-22 AT4G35770 182 / 6e-59 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
Lus10012566 79 / 2e-18 AT5G66040 129 / 1e-39 sulfurtransferase protein 16 (.1.2)
Lus10005635 77 / 2e-17 AT5G66040 144 / 1e-44 sulfurtransferase protein 16 (.1.2)
Lus10041525 75 / 6e-16 AT5G14030 216 / 8e-70 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
Lus10043306 40 / 0.0004 AT4G24750 389 / 3e-137 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G111200 137 / 2e-41 AT2G17850 162 / 5e-52 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.014G131300 117 / 1e-33 AT2G21045 204 / 2e-68 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.002G014900 92 / 2e-23 AT4G35770 151 / 8e-47 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
Potri.005G106400 89 / 1e-21 AT4G35770 199 / 1e-64 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
Potri.006G059200 42 / 7e-05 AT2G42220 318 / 4e-111 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.015G086100 42 / 0.0001 AT4G24750 416 / 1e-147 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.006G100600 39 / 0.0007 AT3G08920 238 / 6e-80 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0031 Phosphatase PF00581 Rhodanese Rhodanese-like domain
Representative CDS sequence
>Lus10028442 pacid=23166099 polypeptide=Lus10028442 locus=Lus10028442.g ID=Lus10028442.BGIv1.0 annot-version=v1.0
ATGGAATTTCTTGTCTTGTTGTTGTTGCTTTTGGTTTCCCGTTGGGTTTGCTACAGTTCTGGAGCTGAAGTAATCACCGTTGATGTTCATAAGGTCAAGT
CTCTTATCCAGTCCGGCCATGTCTATCTTGATGTCAGGACAGAGGAGGAGTTCAAAGCAGCCCACCCCGATGCAGAGACGATATGGAAACTGAGAGGACA
ACCTGAGAAAGAAGCTGATGATGATGTCACAAAGAAGAAGAAGATCATATACAACATTCCTTACATGTTCAACACCTCTCAGGGTCCTCGTTTCCGCTTC
TGTCTGATTCATTTGGTGCGATGCGCCCTCAAACAGTACTTCTCACGTCAGAATGATGTTTCTTCAGGAAGAGTGAAGAATCCTGAGTTCGTGGCAAAGG
TCAAGGAGATGATCAAGGAAGATGACCATCTCGTCGTGGGATGTCAGAGTGGAGCGAGGTCTCTGTCTGCAACTACTGATCTTCTTAGTGCAGGTTTCAA
ACAGGCTTGCAATATGGGTGGAGGGTACCTAGCCTGGGAGAAGAATGGGTTTGAAGTGAAGAAACAACTGAAGCAAGAACTCTGA
AA sequence
>Lus10028442 pacid=23166099 polypeptide=Lus10028442 locus=Lus10028442.g ID=Lus10028442.BGIv1.0 annot-version=v1.0
MEFLVLLLLLLVSRWVCYSSGAEVITVDVHKVKSLIQSGHVYLDVRTEEEFKAAHPDAETIWKLRGQPEKEADDDVTKKKKIIYNIPYMFNTSQGPRFRF
CLIHLVRCALKQYFSRQNDVSSGRVKNPEFVAKVKEMIKEDDHLVVGCQSGARSLSATTDLLSAGFKQACNMGGGYLAWEKNGFEVKKQLKQEL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G66170 STR18 sulfurtransferase 18 (.1.2.3) Lus10028442 0 1
AT5G66170 STR18 sulfurtransferase 18 (.1.2.3) Lus10041895 1.7 0.9128
AT5G06250 B3 AP2/B3-like transcriptional fa... Lus10004226 6.6 0.8308
AT4G03420 Protein of unknown function (D... Lus10018572 8.2 0.8793
AT5G03230 Protein of unknown function, D... Lus10015087 10.7 0.8682
Lus10008583 11.4 0.8014
AT4G36220 CYP84A1, FAH1, ... ferulic acid 5-hydroxylase 1 (... Lus10014273 12.7 0.8593
AT4G39090 EMB3005, RD19A,... RESPONSIVE TO DEHYDRATION 19A,... Lus10017489 17.3 0.8722
AT4G27450 Aluminium induced protein with... Lus10033418 22.7 0.8682
AT4G39090 EMB3005, RD19A,... RESPONSIVE TO DEHYDRATION 19A,... Lus10017487 27.4 0.8638
AT1G16390 3-Oct, ATOCT3 organic cation/carnitine trans... Lus10000286 30.6 0.8676

Lus10028442 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.