Lus10028453 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G36040 135 / 3e-41 J11 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
AT2G17880 135 / 4e-41 Chaperone DnaJ-domain superfamily protein (.1)
AT3G13310 81 / 1e-19 Chaperone DnaJ-domain superfamily protein (.1)
AT4G13830 75 / 1e-17 J20 DNAJ-like 20 (.1.2)
AT4G39960 66 / 7e-13 Molecular chaperone Hsp40/DnaJ family protein (.1)
AT2G22360 63 / 4e-12 DNAJ heat shock family protein (.1)
AT4G37480 62 / 1e-11 Chaperone DnaJ-domain superfamily protein (.1)
AT3G17830 61 / 2e-11 Molecular chaperone Hsp40/DnaJ family protein (.1)
AT1G59980 61 / 3e-11 GPS4, ARL2 ,ATDJC39 gravity persistence signal 4, ARG1-like 2 (.1)
AT1G80030 60 / 4e-11 Molecular chaperone Hsp40/DnaJ family protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041906 209 / 2e-70 AT4G36040 144 / 8e-45 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
Lus10017263 106 / 2e-29 AT4G36040 106 / 2e-29 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
Lus10034484 103 / 5e-29 AT4G36040 100 / 3e-28 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
Lus10025060 92 / 2e-24 AT4G36040 102 / 7e-29 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
Lus10032957 83 / 9e-21 AT3G13310 109 / 2e-31 Chaperone DnaJ-domain superfamily protein (.1)
Lus10013558 78 / 2e-19 AT4G36040 82 / 1e-21 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
Lus10002356 74 / 1e-16 AT4G13830 144 / 1e-43 DNAJ-like 20 (.1.2)
Lus10003150 73 / 2e-16 AT4G13830 151 / 3e-46 DNAJ-like 20 (.1.2)
Lus10002355 72 / 7e-16 AT4G13830 139 / 2e-41 DNAJ-like 20 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G113100 154 / 6e-49 AT2G17880 139 / 6e-43 Chaperone DnaJ-domain superfamily protein (.1)
Potri.004G172300 126 / 1e-37 AT2G17880 115 / 2e-33 Chaperone DnaJ-domain superfamily protein (.1)
Potri.009G131800 120 / 5e-36 AT2G17880 109 / 9e-32 Chaperone DnaJ-domain superfamily protein (.1)
Potri.002G020800 114 / 1e-32 AT2G17880 110 / 3e-31 Chaperone DnaJ-domain superfamily protein (.1)
Potri.005G240700 111 / 1e-31 AT2G17880 105 / 2e-29 Chaperone DnaJ-domain superfamily protein (.1)
Potri.002G020700 110 / 4e-31 AT2G17880 108 / 3e-30 Chaperone DnaJ-domain superfamily protein (.1)
Potri.001G469600 84 / 5e-21 AT3G13310 120 / 4e-35 Chaperone DnaJ-domain superfamily protein (.1)
Potri.011G166500 80 / 3e-19 AT3G13310 115 / 4e-33 Chaperone DnaJ-domain superfamily protein (.1)
Potri.007G107600 76 / 4e-18 AT3G13310 109 / 4e-31 Chaperone DnaJ-domain superfamily protein (.1)
Potri.006G001301 75 / 2e-17 AT3G13310 102 / 2e-28 Chaperone DnaJ-domain superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0392 Chaperone-J PF00226 DnaJ DnaJ domain
Representative CDS sequence
>Lus10028453 pacid=23166021 polypeptide=Lus10028453 locus=Lus10028453.g ID=Lus10028453.BGIv1.0 annot-version=v1.0
ATGATACCCACAGCAGTTATTTCTCCTCCTCTTTCCCCCGTCTTCCAATTCTCCCCCAAATCCCCCTCCTCCTCCTCCTCCGCTTCCGGCCGCCGCTCCC
AATCTGGGCCACCTCCGATCTACAATTCGGCGACCGCGTACAGGGAGAGACCCAGGGTCTCCATGCCTCCTCCTAAGATGCCCTCCTCATCCTCTCTTTA
CGAGATCCTAGGGATTCCGAACGGCGCCTCCAGCCAGGAGATCAAATCGGCCTACAGGAAGCTCGCGAGGACTTGCCATCCAGATGTGGCTGCGATCGAT
CGCAAAGACAACTCCGCTGACGAGTTCATGAGGATCCACGCCGCCTACACCACTCTCTCCGATCCCGAGAGGCGCGTCGTTTACGATCGGAAGCAGCTCT
TCAGGCGGATGCAGCCGCTCACCACCGCCGGATTGTCCGGATACAGCGGGCGGAGCTGGGAGACCGATCAGTGCTGGTGA
AA sequence
>Lus10028453 pacid=23166021 polypeptide=Lus10028453 locus=Lus10028453.g ID=Lus10028453.BGIv1.0 annot-version=v1.0
MIPTAVISPPLSPVFQFSPKSPSSSSSASGRRSQSGPPPIYNSATAYRERPRVSMPPPKMPSSSSLYEILGIPNGASSQEIKSAYRKLARTCHPDVAAID
RKDNSADEFMRIHAAYTTLSDPERRVVYDRKQLFRRMQPLTTAGLSGYSGRSWETDQCW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G17880 Chaperone DnaJ-domain superfam... Lus10028453 0 1
AT4G36040 J11 DnaJ11, Chaperone DnaJ-domain ... Lus10041906 1.0 0.9497
AT1G27290 unknown protein Lus10003121 6.2 0.9282
AT4G39040 RNA-binding CRS1 / YhbY (CRM) ... Lus10028787 6.6 0.8797
AT4G24220 5[beta]-StR, 5[... VEIN PATTERNING 1, Δ4,5-s... Lus10000076 6.8 0.9296
AT3G13750 BGAL1 beta-galactosidase 1, beta gal... Lus10015625 10.2 0.9153
AT2G24550 unknown protein Lus10020142 11.0 0.9201
AT5G27830 unknown protein Lus10029881 11.1 0.9222
AT3G10760 GARP Homeodomain-like superfamily p... Lus10010442 12.9 0.8646
AT5G18650 CHY-type/CTCHY-type/RING-type ... Lus10012811 14.1 0.9142
AT1G75220 AtERDL6 ERD6-like 6, Major facilitator... Lus10041748 14.3 0.9175

Lus10028453 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.