Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041915 [exp] 52 / 8e-10 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G114500 [exp] 45 / 3e-07 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028460 pacid=23166170 polypeptide=Lus10028460 locus=Lus10028460.g ID=Lus10028460.BGIv1.0 annot-version=v1.0 ATGGACACATCATCGCCGCCGCCGTCACCACCGTCACCCAGTCCAAGGAGGAGGAGAACCAAAAAAACCGCAATTCCCTGCCTCCCTAGCCTCAGATCCT CCTCCTCCTCCTCCACCACCTGCTCAGCCATGAACCACCACCGCGTCCCCCCTACGCCCCTTCTAGAACGTTTCCGTGGAGCCGTCTTCCGCCTCATGAT GATCTCCGCTCTTTCCAACTCCTCAGCATCGGTCCCCACCACTCAAGACCAGGGTAAAGAGTAA
AA sequence Show only first row Show all	>Lus10028460 pacid=23166170 polypeptide=Lus10028460 locus=Lus10028460.g ID=Lus10028460.BGIv1.0 annot-version=v1.0 MDTSSPPPSPPSPSPRRRRTKKTAIPCLPSLRSSSSSSTTCSAMNHHRVPPTPLLERFRGAVFRLMMISALSNSSASVPTTQDQGKE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10028460 [exp]	0	1
AT2G27410	B3		Domain of unknown function (DU...		Lus10038980 [exp]	2.0	0.8381
					Lus10022865 [exp]	2.8	0.8157
AT5G18410		ATSRA1, KLK, PI...	PIROGI 121, PIROGI, KLUNKER, t...		Lus10003109 [exp]	6.2	0.8735
AT2G27690		CYP94C1	"cytochrome P450, family 94, s...		Lus10019534 [exp]	7.7	0.8057
					Lus10032788 [exp]	16.9	0.8274
AT1G68390			Core-2/I-branching beta-1,6-N-...		Lus10036610 [exp]	17.9	0.8133
AT5G52390			PAR1 protein (.1)		Lus10040714 [exp]	22.2	0.7666
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Lus10014110 [exp]	28.5	0.7111
AT4G28050		TET7	tetraspanin7 (.1)		Lus10038964 [exp]	31.4	0.7915
					Lus10018591 [exp]	31.5	0.7353

Compare expression of checked genes

Lus10028460 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.